BLASTX nr result
ID: Lithospermum22_contig00027431
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00027431 (533 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAB70510.1| Myb [Nicotiana tabacum] 55 6e-06 >dbj|BAB70510.1| Myb [Nicotiana tabacum] Length = 1003 Score = 55.1 bits (131), Expect = 6e-06 Identities = 29/64 (45%), Positives = 39/64 (60%), Gaps = 6/64 (9%) Frame = +2 Query: 359 DPLMVVDIDHSGSPLSHNVQTSV-GKDPVVQEDHRDSGNLYYEPPHF-----PFLCCDLI 520 D +V ++ GS S+ VQT + ++ VQE+ +D G L Y+PP F PF CCDLI Sbjct: 549 DSSRIVPVNDIGSTTSNTVQTCLLNENSFVQEEQKDGGALCYDPPRFPSSDVPFFCCDLI 608 Query: 521 QSGS 532 QSGS Sbjct: 609 QSGS 612