BLASTX nr result
ID: Lithospermum22_contig00027169
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00027169 (488 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516375.1| Cysteine proteinase inhibitor B, putative [R... 61 8e-08 ref|XP_003552894.1| PREDICTED: cysteine proteinase inhibitor 2-l... 57 2e-06 gb|AAO18638.1| cystatin [Malus x domestica] 56 4e-06 >ref|XP_002516375.1| Cysteine proteinase inhibitor B, putative [Ricinus communis] gi|223544473|gb|EEF45992.1| Cysteine proteinase inhibitor B, putative [Ricinus communis] Length = 138 Score = 61.2 bits (147), Expect = 8e-08 Identities = 33/58 (56%), Positives = 44/58 (75%), Gaps = 2/58 (3%) Frame = -1 Query: 170 TKVKNVEKNQQVQELGKYCVEEYNKVQHTMQKHHHLN--GGERLSFTEVVEAETQVVS 3 T+V++V+ N+ VQELG++CV+E+NK Q Q+H N GGE L F+EVV AETQVVS Sbjct: 31 TQVRDVKSNEAVQELGRFCVKEFNK-QQLRQQHGGSNGGGGELLMFSEVVAAETQVVS 87 >ref|XP_003552894.1| PREDICTED: cysteine proteinase inhibitor 2-like [Glycine max] Length = 142 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/56 (50%), Positives = 41/56 (73%) Frame = -1 Query: 170 TKVKNVEKNQQVQELGKYCVEEYNKVQHTMQKHHHLNGGERLSFTEVVEAETQVVS 3 T++ V KN+QVQELG++ VEEYN ++ ++ NG E+L+F+ VVEA+ QVVS Sbjct: 28 TEIPEVRKNRQVQELGRFAVEEYNLGLKLLKNNNVDNGREQLNFSAVVEAQQQVVS 83 >gb|AAO18638.1| cystatin [Malus x domestica] Length = 123 Score = 55.8 bits (133), Expect = 4e-06 Identities = 27/55 (49%), Positives = 42/55 (76%) Frame = -1 Query: 167 KVKNVEKNQQVQELGKYCVEEYNKVQHTMQKHHHLNGGERLSFTEVVEAETQVVS 3 +++NV+ N++VQELG++ VEEYN+ + T + ++GG L F EVVEA++QVVS Sbjct: 30 EIENVKTNKEVQELGRFSVEEYNRQRGTQK----MDGGGELQFLEVVEAQSQVVS 80