BLASTX nr result
ID: Lithospermum22_contig00027086
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00027086 (497 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003517640.1| PREDICTED: DNA (cytosine-5)-methyltransferas... 58 7e-07 ref|XP_003538899.1| PREDICTED: DNA (cytosine-5)-methyltransferas... 57 2e-06 emb|CBI29991.3| unnamed protein product [Vitis vinifera] 57 2e-06 ref|XP_002275932.1| PREDICTED: DNA (cytosine-5)-methyltransferas... 56 3e-06 gb|AEC12443.1| chromomethylase 3 [Gossypium hirsutum] 55 5e-06 >ref|XP_003517640.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like [Glycine max] Length = 868 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/58 (46%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = -3 Query: 171 PVPDSEARRRWGHHYVMKQKVGEEKSGKSNDEEEDDLVPARRHFTQAKVDG-QIYNLY 1 PVPD EARRRW Y K+K + ++E++++ ARRH+TQA+VDG +Y LY Sbjct: 80 PVPDEEARRRWPKRYQEKEKKQSAGPKSNRNDEDEEIQQARRHYTQAEVDGCMLYKLY 137 >ref|XP_003538899.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Glycine max] Length = 830 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/58 (43%), Positives = 37/58 (63%), Gaps = 1/58 (1%) Frame = -3 Query: 171 PVPDSEARRRWGHHYVMK-QKVGEEKSGKSNDEEEDDLVPARRHFTQAKVDGQIYNLY 1 P+P +EA +W H Y + +K G ++ K E +++PAR H+ QAKVDG +YNLY Sbjct: 42 PIPPAEALAKWPHRYPSEGKKKGSARTSKEATSENSEVMPARCHYRQAKVDGVVYNLY 99 >emb|CBI29991.3| unnamed protein product [Vitis vinifera] Length = 827 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/58 (43%), Positives = 36/58 (62%) Frame = -3 Query: 174 APVPDSEARRRWGHHYVMKQKVGEEKSGKSNDEEEDDLVPARRHFTQAKVDGQIYNLY 1 AP+ +EAR++W Y+ + G + K E +D++ ARRHFT+A VDG IY LY Sbjct: 36 APISVNEARQKWPQRYISTFRKGSDSRTKDESIEAEDILQARRHFTEAVVDGCIYKLY 93 >ref|XP_002275932.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Vitis vinifera] Length = 829 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/60 (43%), Positives = 38/60 (63%), Gaps = 2/60 (3%) Frame = -3 Query: 174 APVPDSEARRRWGHHYVMKQKVGEEKSGKSNDE--EEDDLVPARRHFTQAKVDGQIYNLY 1 AP+ +EAR++W Y+ K + ++ DE E +D++ ARRHFT+A VDG IY LY Sbjct: 36 APISVNEARQKWPQRYISTNKFRKGSDSRTKDESIEAEDILQARRHFTEAVVDGCIYKLY 95 >gb|AEC12443.1| chromomethylase 3 [Gossypium hirsutum] Length = 824 Score = 55.5 bits (132), Expect = 5e-06 Identities = 28/58 (48%), Positives = 40/58 (68%), Gaps = 1/58 (1%) Frame = -3 Query: 171 PVPDSEARRRWGHHYVMKQKVGEEKSGKSNDEEEDDLVPARRHFTQAKVDG-QIYNLY 1 PV D EARRRW Y + K ++ KS++ + ++++ ARRH+TQAKVDG I+NLY Sbjct: 50 PVDDEEARRRWPKRY--QGKGAKKVISKSSNGDSEEIIQARRHYTQAKVDGCMIFNLY 105