BLASTX nr result
ID: Lithospermum22_contig00026721
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00026721 (388 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAO62352.1| subtilase [Casuarina glauca] 55 6e-06 emb|CBI19501.3| unnamed protein product [Vitis vinifera] 55 6e-06 ref|XP_002282841.1| PREDICTED: subtilisin-like protease [Vitis v... 55 6e-06 emb|CAA59964.1| subtilisin-like protease [Alnus glutinosa] 55 8e-06 >gb|AAO62352.1| subtilase [Casuarina glauca] Length = 764 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = +1 Query: 274 LVSPGSFPISSVEKSTYIIHMDKSAMPKIFNSHHHWY 384 L PGS +SVEKSTYI+HMDKS MPK F SHH WY Sbjct: 21 LTLPGSS--ASVEKSTYIVHMDKSHMPKAFTSHHSWY 55 >emb|CBI19501.3| unnamed protein product [Vitis vinifera] Length = 1686 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = +1 Query: 304 SVEKSTYIIHMDKSAMPKIFNSHHHWYS 387 S E+STYIIHMDKS MPK+F +HHHWYS Sbjct: 1205 SGERSTYIIHMDKSVMPKVFATHHHWYS 1232 >ref|XP_002282841.1| PREDICTED: subtilisin-like protease [Vitis vinifera] Length = 770 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = +1 Query: 304 SVEKSTYIIHMDKSAMPKIFNSHHHWYS 387 S E+STYIIHMDKS MPK+F +HHHWYS Sbjct: 31 SGERSTYIIHMDKSVMPKVFATHHHWYS 58 >emb|CAA59964.1| subtilisin-like protease [Alnus glutinosa] Length = 761 Score = 54.7 bits (130), Expect = 8e-06 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = +1 Query: 301 SSVEKSTYIIHMDKSAMPKIFNSHHHWYS 387 +S+EKSTYI+HMDKS MPK F SHH+WYS Sbjct: 28 TSMEKSTYIVHMDKSHMPKAFTSHHNWYS 56