BLASTX nr result
ID: Lithospermum22_contig00026295
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00026295 (203 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269925.1| PREDICTED: mitochondrial intermembrane space... 110 2e-22 ref|XP_002316429.1| predicted protein [Populus trichocarpa] gi|1... 109 3e-22 ref|XP_002513150.1| Intermembrane space import and assembly prot... 107 1e-21 ref|XP_004163217.1| PREDICTED: mitochondrial intermembrane space... 102 4e-20 ref|XP_002874127.1| hypothetical protein ARALYDRAFT_489201 [Arab... 102 4e-20 >ref|XP_002269925.1| PREDICTED: mitochondrial intermembrane space import and assembly protein 40 [Vitis vinifera] gi|147853097|emb|CAN78563.1| hypothetical protein VITISV_010402 [Vitis vinifera] gi|297742718|emb|CBI35352.3| unnamed protein product [Vitis vinifera] Length = 141 Score = 110 bits (274), Expect = 2e-22 Identities = 50/67 (74%), Positives = 61/67 (91%) Frame = -1 Query: 203 TLDSLISEAATYGGNDQNESLEVKAEKALECPCIAHLRTGPCSVQFSNAFVCFLKSTSEE 24 +LD+LI+EAA +G +D+NESL+ KA+KALECPCIAHLR+GPC QFS AFVCFLKS++EE Sbjct: 22 SLDALIAEAAAFG-DDENESLDAKAQKALECPCIAHLRSGPCGTQFSEAFVCFLKSSAEE 80 Query: 23 KGSDCVH 3 KGSDCVH Sbjct: 81 KGSDCVH 87 >ref|XP_002316429.1| predicted protein [Populus trichocarpa] gi|118481972|gb|ABK92917.1| unknown [Populus trichocarpa] gi|222865469|gb|EEF02600.1| predicted protein [Populus trichocarpa] Length = 145 Score = 109 bits (272), Expect = 3e-22 Identities = 50/67 (74%), Positives = 59/67 (88%) Frame = -1 Query: 203 TLDSLISEAATYGGNDQNESLEVKAEKALECPCIAHLRTGPCSVQFSNAFVCFLKSTSEE 24 +++SL++EA YG ND+NESLE KA+KALECPCIA LR GPC VQFS +F+CFLKSTSEE Sbjct: 26 SMESLLAEAVAYG-NDENESLEAKAQKALECPCIADLRNGPCGVQFSESFLCFLKSTSEE 84 Query: 23 KGSDCVH 3 KGSDCVH Sbjct: 85 KGSDCVH 91 >ref|XP_002513150.1| Intermembrane space import and assembly protein 40, mitochondrial precursor, putative [Ricinus communis] gi|223548161|gb|EEF49653.1| Intermembrane space import and assembly protein 40, mitochondrial precursor, putative [Ricinus communis] Length = 135 Score = 107 bits (267), Expect = 1e-21 Identities = 50/67 (74%), Positives = 59/67 (88%) Frame = -1 Query: 203 TLDSLISEAATYGGNDQNESLEVKAEKALECPCIAHLRTGPCSVQFSNAFVCFLKSTSEE 24 +++SLI+EAA YG ND+NESL+ KA+KALECPCIA LR G C +QFS AFVCFLKST+EE Sbjct: 24 SVESLIAEAAAYG-NDENESLDAKAQKALECPCIADLRKGSCGIQFSEAFVCFLKSTAEE 82 Query: 23 KGSDCVH 3 KGSDCVH Sbjct: 83 KGSDCVH 89 >ref|XP_004163217.1| PREDICTED: mitochondrial intermembrane space import and assembly protein 40-like [Cucumis sativus] Length = 159 Score = 102 bits (253), Expect = 4e-20 Identities = 46/67 (68%), Positives = 57/67 (85%) Frame = -1 Query: 203 TLDSLISEAATYGGNDQNESLEVKAEKALECPCIAHLRTGPCSVQFSNAFVCFLKSTSEE 24 +++SLI+EA YG N+ NESL+ KA +ALECPCIA LR GPC +QFS+AF+CF KST+EE Sbjct: 32 SMESLIAEAEAYG-NETNESLDAKANRALECPCIADLRKGPCGIQFSDAFLCFFKSTAEE 90 Query: 23 KGSDCVH 3 KGSDCVH Sbjct: 91 KGSDCVH 97 >ref|XP_002874127.1| hypothetical protein ARALYDRAFT_489201 [Arabidopsis lyrata subsp. lyrata] gi|297319964|gb|EFH50386.1| hypothetical protein ARALYDRAFT_489201 [Arabidopsis lyrata subsp. lyrata] Length = 172 Score = 102 bits (253), Expect = 4e-20 Identities = 47/68 (69%), Positives = 58/68 (85%), Gaps = 1/68 (1%) Frame = -1 Query: 203 TLDSLISEAATYGGND-QNESLEVKAEKALECPCIAHLRTGPCSVQFSNAFVCFLKSTSE 27 ++DSL++EAA YG +D +NESLE KA++AL+CPCIA LR G C QFS AF+CFLKST+E Sbjct: 47 SMDSLLAEAAAYGEDDNENESLEAKAQRALDCPCIADLRNGSCGSQFSEAFLCFLKSTAE 106 Query: 26 EKGSDCVH 3 EKGSDCVH Sbjct: 107 EKGSDCVH 114