BLASTX nr result
ID: Lithospermum22_contig00026286
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00026286 (540 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527914.1| conserved hypothetical protein [Ricinus comm... 55 7e-06 >ref|XP_002527914.1| conserved hypothetical protein [Ricinus communis] gi|223532689|gb|EEF34471.1| conserved hypothetical protein [Ricinus communis] Length = 303 Score = 55.1 bits (131), Expect = 7e-06 Identities = 32/87 (36%), Positives = 47/87 (54%) Frame = -3 Query: 430 VESTIHDEETSRVGENPGLYSSLPPSVANFLARCCTEARQDAAELQKVTDEVHFDYSFTN 251 VE E+T + + S+LPPS A+FL+ CC+E +Q AA+ D V Sbjct: 218 VEQDSQTEKTLPSRNHEDISSALPPSFASFLSNCCSEVQQVAAQPTSFED-VDLKSQIAR 276 Query: 250 HMTASSFNAMLSNLDRVIYDLGGDLAL 170 +M SSF ML +++VI ++G DL L Sbjct: 277 YMEDSSFQEMLIKVEKVISEIGDDLLL 303