BLASTX nr result
ID: Lithospermum22_contig00026224
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00026224 (256 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004171164.1| PREDICTED: 26S protease regulatory subunit 6... 66 3e-09 ref|XP_004144776.1| PREDICTED: 26S protease regulatory subunit 6... 66 3e-09 ref|XP_004135596.1| PREDICTED: 26S protease regulatory subunit 6... 66 3e-09 gb|AAD46145.1| 19S proteasome regulatory complex subunit S6A [Ar... 66 3e-09 ref|NP_187204.1| regulatory particle triple-A ATPase 5A [Arabido... 66 3e-09 >ref|XP_004171164.1| PREDICTED: 26S protease regulatory subunit 6A homolog A-like [Cucumis sativus] Length = 148 Score = 65.9 bits (159), Expect = 3e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 254 RRDATEVNHEDFNEGIIQVQAKKKASLNYYA 162 RRDATEVNHEDFNEGIIQVQAKKKASLNYYA Sbjct: 118 RRDATEVNHEDFNEGIIQVQAKKKASLNYYA 148 >ref|XP_004144776.1| PREDICTED: 26S protease regulatory subunit 6A homolog A-like [Cucumis sativus] Length = 423 Score = 65.9 bits (159), Expect = 3e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 254 RRDATEVNHEDFNEGIIQVQAKKKASLNYYA 162 RRDATEVNHEDFNEGIIQVQAKKKASLNYYA Sbjct: 393 RRDATEVNHEDFNEGIIQVQAKKKASLNYYA 423 >ref|XP_004135596.1| PREDICTED: 26S protease regulatory subunit 6A homolog A-like [Cucumis sativus] gi|449525490|ref|XP_004169750.1| PREDICTED: LOW QUALITY PROTEIN: 26S protease regulatory subunit 6A homolog A-like [Cucumis sativus] Length = 423 Score = 65.9 bits (159), Expect = 3e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 254 RRDATEVNHEDFNEGIIQVQAKKKASLNYYA 162 RRDATEVNHEDFNEGIIQVQAKKKASLNYYA Sbjct: 393 RRDATEVNHEDFNEGIIQVQAKKKASLNYYA 423 >gb|AAD46145.1| 19S proteasome regulatory complex subunit S6A [Arabidopsis thaliana] Length = 424 Score = 65.9 bits (159), Expect = 3e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 254 RRDATEVNHEDFNEGIIQVQAKKKASLNYYA 162 RRDATEVNHEDFNEGIIQVQAKKKASLNYYA Sbjct: 394 RRDATEVNHEDFNEGIIQVQAKKKASLNYYA 424 >ref|NP_187204.1| regulatory particle triple-A ATPase 5A [Arabidopsis thaliana] gi|297829080|ref|XP_002882422.1| regulatory particle triple-a 5A [Arabidopsis lyrata subsp. lyrata] gi|75337114|sp|Q9SEI2.1|PS6AA_ARATH RecName: Full=26S protease regulatory subunit 6A homolog A; AltName: Full=26S proteasome AAA-ATPase subunit RPT5a; AltName: Full=Proteasome 26S subunit 6A homolog A; AltName: Full=Regulatory particle triple-A ATPase subunit 5a; AltName: Full=Tat-binding protein 1 homolog A; Short=TBP-1 homolog A gi|6652886|gb|AAF22525.1|AF123394_1 26S proteasome AAA-ATPase subunit RPT5a [Arabidopsis thaliana] gi|7596759|gb|AAF64530.1| 26S proteasome AAA-ATPase subunit RPT5a [Arabidopsis thaliana] gi|17065258|gb|AAL32783.1| 26S proteasome AAA-ATPase subunit RPT5a [Arabidopsis thaliana] gi|297328262|gb|EFH58681.1| regulatory particle triple-a 5A [Arabidopsis lyrata subsp. lyrata] gi|332640733|gb|AEE74254.1| regulatory particle triple-A ATPase 5A [Arabidopsis thaliana] Length = 424 Score = 65.9 bits (159), Expect = 3e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 254 RRDATEVNHEDFNEGIIQVQAKKKASLNYYA 162 RRDATEVNHEDFNEGIIQVQAKKKASLNYYA Sbjct: 394 RRDATEVNHEDFNEGIIQVQAKKKASLNYYA 424