BLASTX nr result
ID: Lithospermum22_contig00026185
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00026185 (347 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281288.1| PREDICTED: histidine kinase 3-like [Vitis vi... 55 6e-06 >ref|XP_002281288.1| PREDICTED: histidine kinase 3-like [Vitis vinifera] Length = 337 Score = 55.1 bits (131), Expect = 6e-06 Identities = 32/67 (47%), Positives = 42/67 (62%), Gaps = 10/67 (14%) Frame = -2 Query: 259 TFTNEKWCQ-TNCKNQSKSPEFCCMRALVVDSTPVRAKITKYHTQRLGIH---------V 110 + +NE CQ TN ++ + S EF M ALVVD PVRAK++++H QRLGIH V Sbjct: 19 SISNEYKCQPTNNQSNAVSSEFQGMAALVVDPNPVRAKVSRHHIQRLGIHVEVTSDLNQV 78 Query: 109 FSGVLQG 89 FSG+ G Sbjct: 79 FSGISSG 85