BLASTX nr result
ID: Lithospermum22_contig00026130
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00026130 (470 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004140697.1| PREDICTED: protein CYPRO4-like [Cucumis sati... 67 1e-09 ref|XP_003607985.1| DEM2 [Medicago truncatula] gi|355509040|gb|A... 65 6e-09 ref|XP_002510220.1| Protein CYPRO4, putative [Ricinus communis] ... 65 8e-09 ref|NP_188555.1| Vacuolar import/degradation, Vid27-related prot... 64 1e-08 ref|XP_002518769.1| Protein CYPRO4, putative [Ricinus communis] ... 62 4e-08 >ref|XP_004140697.1| PREDICTED: protein CYPRO4-like [Cucumis sativus] gi|449497632|ref|XP_004160456.1| PREDICTED: protein CYPRO4-like [Cucumis sativus] Length = 653 Score = 67.4 bits (163), Expect = 1e-09 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = +2 Query: 347 NPKNAVKLYLHIGGNTPNAKWIVSEKLSYYRFVKTSNLE 463 N KNAVKLYLHIGGNTP AKWIVSEK ++Y F+KT+N++ Sbjct: 85 NSKNAVKLYLHIGGNTPRAKWIVSEKFTFYVFLKTANVD 123 >ref|XP_003607985.1| DEM2 [Medicago truncatula] gi|355509040|gb|AES90182.1| DEM2 [Medicago truncatula] Length = 627 Score = 65.1 bits (157), Expect = 6e-09 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = +2 Query: 350 PKNAVKLYLHIGGNTPNAKWIVSEKLSYYRFVKTSNLEEE 469 PKNAVKLYLHIGGNTPNAKWI+S+K + Y FVK EEE Sbjct: 76 PKNAVKLYLHIGGNTPNAKWILSDKRTSYAFVKNYEDEEE 115 >ref|XP_002510220.1| Protein CYPRO4, putative [Ricinus communis] gi|223550921|gb|EEF52407.1| Protein CYPRO4, putative [Ricinus communis] Length = 639 Score = 64.7 bits (156), Expect = 8e-09 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +2 Query: 347 NPKNAVKLYLHIGGNTPNAKWIVSEKLSYYRFVKTSNL 460 N KNAVKLYLHIGGNTP AKW++SEKL+ Y F+KTS + Sbjct: 74 NLKNAVKLYLHIGGNTPKAKWVLSEKLTSYSFIKTSKI 111 >ref|NP_188555.1| Vacuolar import/degradation, Vid27-related protein [Arabidopsis thaliana] gi|9294626|dbj|BAB02965.1| dem protein [Arabidopsis thaliana] gi|332642691|gb|AEE76212.1| Vacuolar import/degradation, Vid27-related protein [Arabidopsis thaliana] Length = 648 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = +2 Query: 353 KNAVKLYLHIGGNTPNAKWIVSEKLSYYRFVKTSNLEEE 469 KNAVKLY HIGGNTP AKWIVS+K++ Y+FVKTS+++ E Sbjct: 86 KNAVKLYRHIGGNTPKAKWIVSDKMTSYKFVKTSSVDGE 124 >ref|XP_002518769.1| Protein CYPRO4, putative [Ricinus communis] gi|223542150|gb|EEF43694.1| Protein CYPRO4, putative [Ricinus communis] Length = 639 Score = 62.4 bits (150), Expect = 4e-08 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = +2 Query: 350 PKNAVKLYLHIGGNTPNAKWIVSEKLSYYRFVKTSNLE 463 P N VKLYLHIGGNTPNAKW++S+KL+ Y F+K+ N + Sbjct: 80 PNNPVKLYLHIGGNTPNAKWVLSDKLTSYNFIKSCNAD 117