BLASTX nr result
ID: Lithospermum22_contig00025963
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00025963 (201 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002462387.1| hypothetical protein SORBIDRAFT_02g024840 [S... 116 2e-24 ref|XP_004138743.1| PREDICTED: pleiotropic drug resistance prote... 115 3e-24 gb|AEO22189.1| ABCG subfamily transporter protein [Solanum tuber... 115 3e-24 sp|Q76CU2.1|PDR1_TOBAC RecName: Full=Pleiotropic drug resistance... 115 4e-24 dbj|BAB92011.1| pleiotropic drug resistance like protein [Nicoti... 115 4e-24 >ref|XP_002462387.1| hypothetical protein SORBIDRAFT_02g024840 [Sorghum bicolor] gi|241925764|gb|EER98908.1| hypothetical protein SORBIDRAFT_02g024840 [Sorghum bicolor] Length = 1461 Score = 116 bits (291), Expect = 2e-24 Identities = 56/66 (84%), Positives = 60/66 (90%) Frame = +2 Query: 2 PSSGKTTLLLALAGRLDSELKTTGRVSYNGHGVEEFVPQRTSAYISQHDLHIGEMTVRET 181 P SGKTTLLLALAGRLD +LK +GRVSYNGHG+EEFVPQRT+AYISQHDLHI EMTVRET Sbjct: 203 PGSGKTTLLLALAGRLDKDLKVSGRVSYNGHGMEEFVPQRTAAYISQHDLHIAEMTVRET 262 Query: 182 LEFSGR 199 L FS R Sbjct: 263 LAFSAR 268 >ref|XP_004138743.1| PREDICTED: pleiotropic drug resistance protein 1-like [Cucumis sativus] gi|449499585|ref|XP_004160857.1| PREDICTED: pleiotropic drug resistance protein 1-like [Cucumis sativus] Length = 1421 Score = 115 bits (289), Expect = 3e-24 Identities = 56/66 (84%), Positives = 61/66 (92%) Frame = +2 Query: 2 PSSGKTTLLLALAGRLDSELKTTGRVSYNGHGVEEFVPQRTSAYISQHDLHIGEMTVRET 181 PSSGKTTLLLALAG+L +LK +G+VSYNGHG+EEFVPQRTSAYISQHDLHIGEMTVRET Sbjct: 162 PSSGKTTLLLALAGKLGKDLKFSGKVSYNGHGMEEFVPQRTSAYISQHDLHIGEMTVRET 221 Query: 182 LEFSGR 199 L FS R Sbjct: 222 LAFSAR 227 >gb|AEO22189.1| ABCG subfamily transporter protein [Solanum tuberosum] Length = 1423 Score = 115 bits (289), Expect = 3e-24 Identities = 55/66 (83%), Positives = 63/66 (95%) Frame = +2 Query: 2 PSSGKTTLLLALAGRLDSELKTTGRVSYNGHGVEEFVPQRTSAYISQHDLHIGEMTVRET 181 PSSGKTTLLLALAG+LD++LK +GRV+YNGHG++EFVPQRTSAYISQ+DLHIGEMTVRET Sbjct: 190 PSSGKTTLLLALAGKLDNDLKVSGRVTYNGHGMDEFVPQRTSAYISQNDLHIGEMTVRET 249 Query: 182 LEFSGR 199 L FS R Sbjct: 250 LAFSAR 255 Score = 78.6 bits (192), Expect = 5e-13 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +2 Query: 74 RVSYNGHGVEEFVPQRTSAYISQHDLHIGEMTVRETLEFSGR 199 RV+YNGHG++EFVPQRTSAYISQ+DLHIGEMTVRETL FS R Sbjct: 352 RVTYNGHGMDEFVPQRTSAYISQNDLHIGEMTVRETLAFSAR 393 >sp|Q76CU2.1|PDR1_TOBAC RecName: Full=Pleiotropic drug resistance protein 1; AltName: Full=NtPDR1 gi|41052472|dbj|BAD07483.1| PDR-type ABC transporter 1 [Nicotiana tabacum] Length = 1434 Score = 115 bits (288), Expect = 4e-24 Identities = 56/66 (84%), Positives = 60/66 (90%) Frame = +2 Query: 2 PSSGKTTLLLALAGRLDSELKTTGRVSYNGHGVEEFVPQRTSAYISQHDLHIGEMTVRET 181 PSSGKTTLLLALAG+LD LK TG+VSYNGH + EFVPQRT+AYISQHDLHIGEMTVRET Sbjct: 196 PSSGKTTLLLALAGKLDPALKVTGKVSYNGHELHEFVPQRTAAYISQHDLHIGEMTVRET 255 Query: 182 LEFSGR 199 LEFS R Sbjct: 256 LEFSAR 261 >dbj|BAB92011.1| pleiotropic drug resistance like protein [Nicotiana tabacum] Length = 1434 Score = 115 bits (288), Expect = 4e-24 Identities = 56/66 (84%), Positives = 60/66 (90%) Frame = +2 Query: 2 PSSGKTTLLLALAGRLDSELKTTGRVSYNGHGVEEFVPQRTSAYISQHDLHIGEMTVRET 181 PSSGKTTLLLALAG+LD LK TG+VSYNGH + EFVPQRT+AYISQHDLHIGEMTVRET Sbjct: 196 PSSGKTTLLLALAGKLDPALKVTGKVSYNGHELHEFVPQRTAAYISQHDLHIGEMTVRET 255 Query: 182 LEFSGR 199 LEFS R Sbjct: 256 LEFSAR 261