BLASTX nr result
ID: Lithospermum22_contig00025749
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00025749 (223 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003612435.1| hypothetical protein MTR_5g024980 [Medicago ... 60 2e-07 >ref|XP_003612435.1| hypothetical protein MTR_5g024980 [Medicago truncatula] gi|355513770|gb|AES95393.1| hypothetical protein MTR_5g024980 [Medicago truncatula] Length = 286 Score = 59.7 bits (143), Expect = 2e-07 Identities = 33/54 (61%), Positives = 38/54 (70%) Frame = -2 Query: 162 G*ERSSTTRGLEPSTQAVNHALVSQP*FIHQT*FLVSLELKDTDVRAYRTDPVQ 1 G ERSST AVNHAL+++ FIHQT VSLE+KDT VR+YRTDPVQ Sbjct: 11 GRERSSTAEDDAHIILAVNHALITRSWFIHQTYVPVSLEIKDTVVRSYRTDPVQ 64