BLASTX nr result
ID: Lithospermum22_contig00025728
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00025728 (414 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003556647.1| PREDICTED: pentatricopeptide repeat-containi... 130 8e-29 ref|XP_002271063.1| PREDICTED: pentatricopeptide repeat-containi... 126 2e-27 ref|XP_003547411.1| PREDICTED: pentatricopeptide repeat-containi... 120 1e-25 ref|XP_002975120.1| hypothetical protein SELMODRAFT_102603 [Sela... 119 3e-25 ref|XP_002275546.2| PREDICTED: pentatricopeptide repeat-containi... 118 4e-25 >ref|XP_003556647.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Glycine max] Length = 821 Score = 130 bits (328), Expect = 8e-29 Identities = 58/73 (79%), Positives = 66/73 (90%) Frame = -3 Query: 412 LLWGHSERLAISLGLLHTPPGSVIRIRKNLRVCNDCHNVTKIISKLVQREIVVRDANRFH 233 LLWGHSERLAI+ GLL TP GS+I+I KNLRVC DCHNVTK ISK+VQREI+VRDANRFH Sbjct: 749 LLWGHSERLAIAFGLLSTPCGSLIKITKNLRVCVDCHNVTKYISKIVQREIIVRDANRFH 808 Query: 232 HFVDGRCSCRDYW 194 HFV+G+CSC D+W Sbjct: 809 HFVNGKCSCNDFW 821 >ref|XP_002271063.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Vitis vinifera] Length = 805 Score = 126 bits (317), Expect = 2e-27 Identities = 56/73 (76%), Positives = 63/73 (86%) Frame = -3 Query: 412 LLWGHSERLAISLGLLHTPPGSVIRIRKNLRVCNDCHNVTKIISKLVQREIVVRDANRFH 233 +LWGHSERLAI+ GLL TP GS+IRI KNLRVC DCH VTK ISK+V+REI+VRDANRFH Sbjct: 733 MLWGHSERLAIAFGLLTTPAGSLIRITKNLRVCGDCHTVTKYISKIVKREIIVRDANRFH 792 Query: 232 HFVDGRCSCRDYW 194 HF +G CSC DYW Sbjct: 793 HFSNGECSCGDYW 805 >ref|XP_003547411.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic-like [Glycine max] Length = 1135 Score = 120 bits (301), Expect = 1e-25 Identities = 52/73 (71%), Positives = 61/73 (83%) Frame = -3 Query: 412 LLWGHSERLAISLGLLHTPPGSVIRIRKNLRVCNDCHNVTKIISKLVQREIVVRDANRFH 233 +L GHSERLAI+ GLL+TPPG+ IR+ KNLRVCNDCH TKIISK+V REI++RD RFH Sbjct: 1063 MLCGHSERLAIAFGLLNTPPGTTIRVAKNLRVCNDCHVATKIISKIVDREIILRDVRRFH 1122 Query: 232 HFVDGRCSCRDYW 194 HF +G CSC DYW Sbjct: 1123 HFANGTCSCGDYW 1135 >ref|XP_002975120.1| hypothetical protein SELMODRAFT_102603 [Selaginella moellendorffii] gi|300157279|gb|EFJ23905.1| hypothetical protein SELMODRAFT_102603 [Selaginella moellendorffii] Length = 485 Score = 119 bits (298), Expect = 3e-25 Identities = 51/73 (69%), Positives = 61/73 (83%) Frame = -3 Query: 412 LLWGHSERLAISLGLLHTPPGSVIRIRKNLRVCNDCHNVTKIISKLVQREIVVRDANRFH 233 LLW HSE+LAI+ GL+ TPPG+ +RI KNLRVC+DCH TK+ISK+ REI+VRD NRFH Sbjct: 413 LLWYHSEKLAIAFGLISTPPGAPLRIVKNLRVCSDCHAATKVISKVTGREILVRDTNRFH 472 Query: 232 HFVDGRCSCRDYW 194 HF+DG CSC DYW Sbjct: 473 HFLDGMCSCNDYW 485 >ref|XP_002275546.2| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic-like [Vitis vinifera] Length = 896 Score = 118 bits (296), Expect = 4e-25 Identities = 50/73 (68%), Positives = 61/73 (83%) Frame = -3 Query: 412 LLWGHSERLAISLGLLHTPPGSVIRIRKNLRVCNDCHNVTKIISKLVQREIVVRDANRFH 233 LL GHSE+LAI+ G+L+TPPG+ IR+ KNLRVCNDCH TK ISK+++REI+VRD RFH Sbjct: 824 LLCGHSEKLAIAFGILNTPPGTTIRVAKNLRVCNDCHAATKFISKIMEREIIVRDVRRFH 883 Query: 232 HFVDGRCSCRDYW 194 HF +G CSC DYW Sbjct: 884 HFKEGTCSCGDYW 896