BLASTX nr result
ID: Lithospermum22_contig00025662
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00025662 (447 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P00053.1|CYC_CANSA RecName: Full=Cytochrome c gi|229471|prf||... 119 3e-25 sp|P00062.1|CYC_SAMNI RecName: Full=Cytochrome c 119 3e-25 ref|NP_192742.1| cytochrome c-2 [Arabidopsis thaliana] gi|297809... 118 4e-25 gb|AFK42359.1| unknown [Lotus japonicus] gi|388517779|gb|AFK4695... 118 4e-25 ref|NP_001235212.1| uncharacterized protein LOC100305937 [Glycin... 118 6e-25 >sp|P00053.1|CYC_CANSA RecName: Full=Cytochrome c gi|229471|prf||732192A cytochrome c Length = 111 Score = 119 bits (297), Expect = 3e-25 Identities = 53/59 (89%), Positives = 58/59 (98%) Frame = -3 Query: 445 GYSYSAANKSMAVTWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKNSTA 269 GYSYSAANK+MAVTW++KTLYDYLLNPKKYIPGTKMVFPGLKKP++RADLIAYLK STA Sbjct: 53 GYSYSAANKNMAVTWZZKTLYDYLLNPKKYIPGTKMVFPGLKKPZBRADLIAYLKESTA 111 >sp|P00062.1|CYC_SAMNI RecName: Full=Cytochrome c Length = 111 Score = 119 bits (297), Expect = 3e-25 Identities = 56/59 (94%), Positives = 57/59 (96%) Frame = -3 Query: 445 GYSYSAANKSMAVTWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKNSTA 269 GYSYSAANK+MAV WEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLK STA Sbjct: 53 GYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKQSTA 111 >ref|NP_192742.1| cytochrome c-2 [Arabidopsis thaliana] gi|297809203|ref|XP_002872485.1| cytochrome C-2 [Arabidopsis lyrata subsp. lyrata] gi|27734261|sp|Q9T0G2.1|CYC3_ARATH RecName: Full=Probable cytochrome c At4g10040 gi|4539007|emb|CAB39628.1| cytochrome c [Arabidopsis thaliana] gi|7267700|emb|CAB78127.1| cytochrome c [Arabidopsis thaliana] gi|15028283|gb|AAK76618.1| putative cytochrome c protein [Arabidopsis thaliana] gi|19310747|gb|AAL85104.1| putative cytochrome c protein [Arabidopsis thaliana] gi|21592668|gb|AAM64617.1| cytochrome c [Arabidopsis thaliana] gi|297318322|gb|EFH48744.1| cytochrome C-2 [Arabidopsis lyrata subsp. lyrata] gi|332657432|gb|AEE82832.1| cytochrome c-2 [Arabidopsis thaliana] Length = 112 Score = 118 bits (296), Expect = 4e-25 Identities = 56/59 (94%), Positives = 56/59 (94%) Frame = -3 Query: 445 GYSYSAANKSMAVTWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKNSTA 269 GYSYSAANKSMAV WEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLK TA Sbjct: 54 GYSYSAANKSMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKEGTA 112 >gb|AFK42359.1| unknown [Lotus japonicus] gi|388517779|gb|AFK46951.1| unknown [Lotus japonicus] Length = 113 Score = 118 bits (296), Expect = 4e-25 Identities = 56/59 (94%), Positives = 57/59 (96%) Frame = -3 Query: 445 GYSYSAANKSMAVTWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKNSTA 269 GYSYSAANK+MAV WEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLK STA Sbjct: 54 GYSYSAANKNMAVIWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKQSTA 112 >ref|NP_001235212.1| uncharacterized protein LOC100305937 [Glycine max] gi|255627031|gb|ACU13860.1| unknown [Glycine max] Length = 113 Score = 118 bits (295), Expect = 6e-25 Identities = 55/59 (93%), Positives = 58/59 (98%) Frame = -3 Query: 445 GYSYSAANKSMAVTWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKNSTA 269 GYSYS+ANK+MAVTWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQ+RADLIAYLK STA Sbjct: 54 GYSYSSANKNMAVTWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKESTA 112