BLASTX nr result
ID: Lithospermum22_contig00025311
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00025311 (214 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAD23883.1| putative retroelement pol polyprotein [Arabidopsi... 44 2e-06 gb|AAD19784.1| putative retroelement pol polyprotein [Arabidopsi... 44 1e-05 >gb|AAD23883.1| putative retroelement pol polyprotein [Arabidopsis thaliana] Length = 1156 Score = 43.5 bits (101), Expect(2) = 2e-06 Identities = 20/46 (43%), Positives = 30/46 (65%), Gaps = 1/46 (2%) Frame = +3 Query: 78 RVNTVVARQDPVLWHQRLGHPSAKIVQTLPFNFVSSDSL-NKTCDV 212 +++T D LWHQRLGHPS ++ +LP SS S+ +++CDV Sbjct: 78 KIHTAKVSSDQALWHQRLGHPSFSVLSSLPVLTSSSLSVGSRSCDV 123 Score = 32.7 bits (73), Expect(2) = 2e-06 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +1 Query: 1 DRFSRTLIGLGERMGRLYYLRAILT 75 DRFSRTLIG GE +YYL + T Sbjct: 52 DRFSRTLIGSGEERDGVYYLTDVAT 76 >gb|AAD19784.1| putative retroelement pol polyprotein [Arabidopsis thaliana] Length = 1501 Score = 44.3 bits (103), Expect(2) = 1e-05 Identities = 20/46 (43%), Positives = 29/46 (63%), Gaps = 1/46 (2%) Frame = +3 Query: 78 RVNTVVARQDPVLWHQRLGHPSAKIVQTLP-FNFVSSDSLNKTCDV 212 +++T D LWHQRLGHPS ++ +LP F+ SS + +CDV Sbjct: 517 KIHTANVDSDQALWHQRLGHPSFSVLSSLPLFSKTSSTVTSHSCDV 562 Score = 29.6 bits (65), Expect(2) = 1e-05 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = +1 Query: 1 DRFSRTLIGLGERMGRLYYL 60 DR S+TLIG GE G +YYL Sbjct: 491 DRSSKTLIGSGEERGGVYYL 510