BLASTX nr result
ID: Lithospermum22_contig00025261
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00025261 (239 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003536139.1| PREDICTED: uncharacterized protein LOC100791... 81 1e-13 ref|XP_004139394.1| PREDICTED: uncharacterized protein LOC101222... 80 2e-13 ref|XP_003590966.1| hypothetical protein MTR_1g080210 [Medicago ... 80 2e-13 ref|XP_002521975.1| conserved hypothetical protein [Ricinus comm... 79 3e-13 ref|XP_002325335.1| predicted protein [Populus trichocarpa] gi|2... 79 3e-13 >ref|XP_003536139.1| PREDICTED: uncharacterized protein LOC100791424 [Glycine max] Length = 176 Score = 80.9 bits (198), Expect = 1e-13 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -3 Query: 114 SRYENQKRRDWMTFCQYLRNHRPPLPLSLCSGAHVLEF 1 SRYENQKRRDW TFCQYLRNHRPPL L+LCSGAHVLEF Sbjct: 36 SRYENQKRRDWNTFCQYLRNHRPPLSLALCSGAHVLEF 73 >ref|XP_004139394.1| PREDICTED: uncharacterized protein LOC101222316 [Cucumis sativus] gi|449520839|ref|XP_004167440.1| PREDICTED: uncharacterized LOC101222316 [Cucumis sativus] Length = 189 Score = 79.7 bits (195), Expect = 2e-13 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = -3 Query: 114 SRYENQKRRDWMTFCQYLRNHRPPLPLSLCSGAHVLEF 1 SRYENQKRRDW TFCQYLRNHRPPL L +CSGAHVLEF Sbjct: 38 SRYENQKRRDWNTFCQYLRNHRPPLALQMCSGAHVLEF 75 >ref|XP_003590966.1| hypothetical protein MTR_1g080210 [Medicago truncatula] gi|355480014|gb|AES61217.1| hypothetical protein MTR_1g080210 [Medicago truncatula] Length = 209 Score = 79.7 bits (195), Expect = 2e-13 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -3 Query: 114 SRYENQKRRDWMTFCQYLRNHRPPLPLSLCSGAHVLEF 1 SRYENQKRRDW TFCQYLRNHRPPL L+LCSG+HVLEF Sbjct: 39 SRYENQKRRDWNTFCQYLRNHRPPLSLALCSGSHVLEF 76 >ref|XP_002521975.1| conserved hypothetical protein [Ricinus communis] gi|223538779|gb|EEF40379.1| conserved hypothetical protein [Ricinus communis] Length = 198 Score = 79.3 bits (194), Expect = 3e-13 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = -3 Query: 114 SRYENQKRRDWMTFCQYLRNHRPPLPLSLCSGAHVLEF 1 SRYENQKRRDW TFCQYLRNHRPPL L +CSGAHVLEF Sbjct: 45 SRYENQKRRDWNTFCQYLRNHRPPLSLPMCSGAHVLEF 82 >ref|XP_002325335.1| predicted protein [Populus trichocarpa] gi|222862210|gb|EEE99716.1| predicted protein [Populus trichocarpa] Length = 139 Score = 79.3 bits (194), Expect = 3e-13 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = -3 Query: 114 SRYENQKRRDWMTFCQYLRNHRPPLPLSLCSGAHVLEF 1 SRYENQKRRDW TFCQYLRNHRPPL L +CSGAHVLEF Sbjct: 5 SRYENQKRRDWNTFCQYLRNHRPPLTLPMCSGAHVLEF 42