BLASTX nr result
ID: Lithospermum22_contig00025253
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00025253 (331 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN83506.1| hypothetical protein VITISV_027576 [Vitis vinifera] 55 6e-06 emb|CAN74561.1| hypothetical protein VITISV_017064 [Vitis vinifera] 55 6e-06 gb|AAK43485.1|AC084807_10 polyprotein, putative [Arabidopsis tha... 55 8e-06 >emb|CAN83506.1| hypothetical protein VITISV_027576 [Vitis vinifera] Length = 1172 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/49 (46%), Positives = 34/49 (69%) Frame = -3 Query: 221 VESEPHNFTQANQCPLWRAAMCDQINAMVRTQTWSLVPQSPTMNIVGCR 75 ++ EP TQA + P WR AM ++ +A+VR TW LVP +P+ N+VGC+ Sbjct: 652 LDLEPTTPTQALKDPKWRKAMSEEYDALVRNGTWELVPSNPSQNVVGCK 700 >emb|CAN74561.1| hypothetical protein VITISV_017064 [Vitis vinifera] Length = 801 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/52 (44%), Positives = 35/52 (67%) Frame = -3 Query: 230 VVNVESEPHNFTQANQCPLWRAAMCDQINAMVRTQTWSLVPQSPTMNIVGCR 75 ++ SEPH ++QA++ W AM + A++R +TWSLVP P+ +IVGCR Sbjct: 203 LMQTTSEPHTYSQASKSEPWVQAMQHEYQALLRNRTWSLVPHPPSAHIVGCR 254 >gb|AAK43485.1|AC084807_10 polyprotein, putative [Arabidopsis thaliana] gi|225898008|dbj|BAH30336.1| hypothetical protein [Arabidopsis thaliana] Length = 1459 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/47 (51%), Positives = 31/47 (65%) Frame = -3 Query: 215 SEPHNFTQANQCPLWRAAMCDQINAMVRTQTWSLVPQSPTMNIVGCR 75 SEP+ TQA + WR AM D+ +A R TW LVP +PT ++VGCR Sbjct: 948 SEPNTVTQALKDKKWRFAMSDEFDAQQRNHTWDLVPPNPTQHLVGCR 994