BLASTX nr result
ID: Lithospermum22_contig00025252
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00025252 (336 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK42242.1| unknown [Lotus japonicus] 75 4e-12 ref|XP_003615162.1| Subunit 6b of cytochrome c oxidase [Medicago... 75 4e-12 ref|XP_003557780.1| PREDICTED: cytochrome c oxidase subunit 6b-1... 74 9e-12 ref|NP_001236320.1| uncharacterized protein LOC100306272 [Glycin... 74 9e-12 ref|NP_001131473.1| uncharacterized protein LOC100192808 [Zea ma... 74 9e-12 >gb|AFK42242.1| unknown [Lotus japonicus] Length = 177 Score = 75.5 bits (184), Expect = 4e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 334 KFAKYYRALCPGEWVDRWNEQRENGTFPGPL 242 KFAKYYRALCPGEWVDRWNEQRENGTFPGPL Sbjct: 147 KFAKYYRALCPGEWVDRWNEQRENGTFPGPL 177 >ref|XP_003615162.1| Subunit 6b of cytochrome c oxidase [Medicago truncatula] gi|355516497|gb|AES98120.1| Subunit 6b of cytochrome c oxidase [Medicago truncatula] gi|388493660|gb|AFK34896.1| unknown [Medicago truncatula] Length = 183 Score = 75.5 bits (184), Expect = 4e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 334 KFAKYYRALCPGEWVDRWNEQRENGTFPGPL 242 KFAKYYRALCPGEWVDRWNEQRENGTFPGPL Sbjct: 153 KFAKYYRALCPGEWVDRWNEQRENGTFPGPL 183 >ref|XP_003557780.1| PREDICTED: cytochrome c oxidase subunit 6b-1-like [Brachypodium distachyon] Length = 172 Score = 74.3 bits (181), Expect = 9e-12 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 334 KFAKYYRALCPGEWVDRWNEQRENGTFPGPL 242 KFAKYYR+LCPGEWVDRWNEQRENGTFPGPL Sbjct: 142 KFAKYYRSLCPGEWVDRWNEQRENGTFPGPL 172 >ref|NP_001236320.1| uncharacterized protein LOC100306272 [Glycine max] gi|255628065|gb|ACU14377.1| unknown [Glycine max] Length = 174 Score = 74.3 bits (181), Expect = 9e-12 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 334 KFAKYYRALCPGEWVDRWNEQRENGTFPGPL 242 KFAKYYR+LCPGEWVDRWNEQRENGTFPGPL Sbjct: 144 KFAKYYRSLCPGEWVDRWNEQRENGTFPGPL 174 >ref|NP_001131473.1| uncharacterized protein LOC100192808 [Zea mays] gi|195608900|gb|ACG26280.1| cytochrome c oxidase subunit [Zea mays] Length = 172 Score = 74.3 bits (181), Expect = 9e-12 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 334 KFAKYYRALCPGEWVDRWNEQRENGTFPGPL 242 KFAKYYR+LCPGEWVDRWNEQRENGTFPGPL Sbjct: 142 KFAKYYRSLCPGEWVDRWNEQRENGTFPGPL 172