BLASTX nr result
ID: Lithospermum22_contig00025172
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00025172 (216 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632714.1| PREDICTED: PHD finger protein ING2-like [Vit... 80 2e-13 emb|CAN71661.1| hypothetical protein VITISV_016186 [Vitis vinifera] 80 2e-13 ref|NP_974026.1| PHD finger protein-like protein [Arabidopsis th... 80 2e-13 ref|NP_974025.1| PHD finger protein-like protein [Arabidopsis th... 80 2e-13 ref|NP_564658.2| PHD finger protein-like protein [Arabidopsis th... 80 2e-13 >ref|XP_003632714.1| PREDICTED: PHD finger protein ING2-like [Vitis vinifera] gi|297739750|emb|CBI29932.3| unnamed protein product [Vitis vinifera] Length = 259 Score = 80.1 bits (196), Expect = 2e-13 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = +1 Query: 88 MAIARTGVFVDDYLEYSSTLPAELQRLLNTVRELDERSQGLIN 216 MAIARTGVFVDDYL+Y+STLPAELQRLLNT+RELDERSQ +IN Sbjct: 1 MAIARTGVFVDDYLDYASTLPAELQRLLNTIRELDERSQSMIN 43 >emb|CAN71661.1| hypothetical protein VITISV_016186 [Vitis vinifera] Length = 259 Score = 80.1 bits (196), Expect = 2e-13 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = +1 Query: 88 MAIARTGVFVDDYLEYSSTLPAELQRLLNTVRELDERSQGLIN 216 MAIARTGVFVDDYL+Y+STLPAELQRLLNT+RELDERSQ +IN Sbjct: 1 MAIARTGVFVDDYLDYASTLPAELQRLLNTIRELDERSQSMIN 43 >ref|NP_974026.1| PHD finger protein-like protein [Arabidopsis thaliana] gi|42571873|ref|NP_974027.1| PHD finger protein-like protein [Arabidopsis thaliana] gi|353558867|sp|B3H615.1|ING2_ARATH RecName: Full=PHD finger protein ING2; AltName: Full=Protein INHIBITOR OF GROWTH 2; Short=Protein AtING2 gi|222423321|dbj|BAH19636.1| AT1G54390 [Arabidopsis thaliana] gi|332194972|gb|AEE33093.1| PHD finger protein-like protein [Arabidopsis thaliana] gi|332194974|gb|AEE33095.1| PHD finger protein-like protein [Arabidopsis thaliana] Length = 262 Score = 79.7 bits (195), Expect = 2e-13 Identities = 39/43 (90%), Positives = 41/43 (95%) Frame = +1 Query: 88 MAIARTGVFVDDYLEYSSTLPAELQRLLNTVRELDERSQGLIN 216 MAIARTGV+VDDYLEY+ST PAELQRLLNTVRELDERSQ LIN Sbjct: 1 MAIARTGVYVDDYLEYASTFPAELQRLLNTVRELDERSQSLIN 43 >ref|NP_974025.1| PHD finger protein-like protein [Arabidopsis thaliana] gi|332194975|gb|AEE33096.1| PHD finger protein-like protein [Arabidopsis thaliana] Length = 328 Score = 79.7 bits (195), Expect = 2e-13 Identities = 39/43 (90%), Positives = 41/43 (95%) Frame = +1 Query: 88 MAIARTGVFVDDYLEYSSTLPAELQRLLNTVRELDERSQGLIN 216 MAIARTGV+VDDYLEY+ST PAELQRLLNTVRELDERSQ LIN Sbjct: 1 MAIARTGVYVDDYLEYASTFPAELQRLLNTVRELDERSQSLIN 43 >ref|NP_564658.2| PHD finger protein-like protein [Arabidopsis thaliana] gi|20466225|gb|AAM20430.1| unknown protein [Arabidopsis thaliana] gi|25084083|gb|AAN72170.1| unknown protein [Arabidopsis thaliana] gi|332194973|gb|AEE33094.1| PHD finger protein-like protein [Arabidopsis thaliana] Length = 306 Score = 79.7 bits (195), Expect = 2e-13 Identities = 39/43 (90%), Positives = 41/43 (95%) Frame = +1 Query: 88 MAIARTGVFVDDYLEYSSTLPAELQRLLNTVRELDERSQGLIN 216 MAIARTGV+VDDYLEY+ST PAELQRLLNTVRELDERSQ LIN Sbjct: 1 MAIARTGVYVDDYLEYASTFPAELQRLLNTVRELDERSQSLIN 43