BLASTX nr result
ID: Lithospermum22_contig00024997
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00024997 (499 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002439068.1| hypothetical protein SORBIDRAFT_10g031000 [S... 55 4e-06 ref|NP_001147067.1| hexose transporter [Zea mays] gi|224028693|g... 55 4e-06 gb|ACG25339.1| hexose transporter [Zea mays] 55 4e-06 gb|AAD30608.1|AC007369_18 Sugar transporter [Arabidopsis thaliana] 55 6e-06 >ref|XP_002439068.1| hypothetical protein SORBIDRAFT_10g031000 [Sorghum bicolor] gi|241917291|gb|EER90435.1| hypothetical protein SORBIDRAFT_10g031000 [Sorghum bicolor] Length = 767 Score = 55.5 bits (132), Expect = 4e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -1 Query: 499 SPRWLVSKGKKKEARKVLQMICGREDVSGTFALL 398 SPRWLVSKG+ KEAR +LQM+ GREDVSG ALL Sbjct: 188 SPRWLVSKGRMKEARAILQMLRGREDVSGEMALL 221 >ref|NP_001147067.1| hexose transporter [Zea mays] gi|224028693|gb|ACN33422.1| unknown [Zea mays] gi|413935061|gb|AFW69612.1| hexose transporter [Zea mays] Length = 763 Score = 55.5 bits (132), Expect = 4e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -1 Query: 499 SPRWLVSKGKKKEARKVLQMICGREDVSGTFALL 398 SPRWLVSKG+ KEAR +LQM+ GREDVSG ALL Sbjct: 188 SPRWLVSKGRMKEARAILQMLRGREDVSGEMALL 221 >gb|ACG25339.1| hexose transporter [Zea mays] Length = 763 Score = 55.5 bits (132), Expect = 4e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -1 Query: 499 SPRWLVSKGKKKEARKVLQMICGREDVSGTFALL 398 SPRWLVSKG+ KEAR +LQM+ GREDVSG ALL Sbjct: 188 SPRWLVSKGRMKEARAILQMLRGREDVSGEMALL 221 >gb|AAD30608.1|AC007369_18 Sugar transporter [Arabidopsis thaliana] Length = 734 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -1 Query: 499 SPRWLVSKGKKKEARKVLQMICGREDVSGTFALL 398 SPRWLVSKG+ EA++VLQ +CGREDV+G ALL Sbjct: 186 SPRWLVSKGRMDEAKRVLQQLCGREDVTGKMALL 219