BLASTX nr result
ID: Lithospermum22_contig00024732
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00024732 (238 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|Q41495.1|ST14_SOLTU RecName: Full=STS14 protein; Flags: Precu... 65 6e-09 ref|XP_003611867.1| Sts14 protein [Medicago truncatula] gi|35551... 59 3e-07 >sp|Q41495.1|ST14_SOLTU RecName: Full=STS14 protein; Flags: Precursor gi|11177146|gb|AAG32153.1|U17111_1 pistil-specific; similar to PR-1 proteins, Swiss-Prot Accession Number P11670 [Solanum tuberosum] gi|1236785|emb|CAA57976.1| sts14 [Solanum tuberosum] gi|1589691|prf||2211417A sts14 gene Length = 214 Score = 65.1 bits (157), Expect = 6e-09 Identities = 33/76 (43%), Positives = 46/76 (60%), Gaps = 1/76 (1%) Frame = +3 Query: 12 FIPLLAIISLTIFCKVAGRRIPPTRSPAV-AATPQASTIQDYLDAHNKARTEVKVPPMKW 188 F L + + + ++ + +PP P AATP + Q++LDAHNKAR+EV V P+ W Sbjct: 38 FFQFLLLTTASSLTHISAQTVPPPPPPPTSAATPPSRAAQEFLDAHNKARSEVGVGPLTW 97 Query: 189 SNDLAKAASMQVRYQR 236 S LAK S+ VRYQR Sbjct: 98 SPMLAKETSLLVRYQR 113 >ref|XP_003611867.1| Sts14 protein [Medicago truncatula] gi|355513202|gb|AES94825.1| Sts14 protein [Medicago truncatula] Length = 185 Score = 59.3 bits (142), Expect = 3e-07 Identities = 34/81 (41%), Positives = 45/81 (55%), Gaps = 3/81 (3%) Frame = +3 Query: 3 MTKFIPL---LAIISLTIFCKVAGRRIPPTRSPAVAATPQASTIQDYLDAHNKARTEVKV 173 M + PL LA +SL + A R T P A P +++L++HNKAR EV V Sbjct: 3 MLHYFPLFFSLATLSLLLVSSTAARPAATTPEPT-APPPLTPAAKEFLESHNKARAEVGV 61 Query: 174 PPMKWSNDLAKAASMQVRYQR 236 P++WS LAK S+ VRYQR Sbjct: 62 EPLQWSEKLAKDTSLLVRYQR 82