BLASTX nr result
ID: Lithospermum22_contig00024730
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00024730 (221 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADL36631.1| C2H2L domain class transcription factor [Malus x ... 55 6e-06 >gb|ADL36631.1| C2H2L domain class transcription factor [Malus x domestica] Length = 630 Score = 55.1 bits (131), Expect = 6e-06 Identities = 32/49 (65%), Positives = 36/49 (73%), Gaps = 7/49 (14%) Frame = +3 Query: 90 NLTRSQLIGQSGQLPMLTG----QATQFNLQSQLLTSPRQK---MQGAQ 215 NL+RS LIGQSG LPML+G A QFNLQ QLL SPRQK +QG+Q Sbjct: 185 NLSRSALIGQSGHLPMLSGPAAVAAAQFNLQPQLLASPRQKGSLVQGSQ 233