BLASTX nr result
ID: Lithospermum22_contig00024623
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00024623 (241 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002319239.1| predicted protein [Populus trichocarpa] gi|2... 55 6e-06 >ref|XP_002319239.1| predicted protein [Populus trichocarpa] gi|222857615|gb|EEE95162.1| predicted protein [Populus trichocarpa] Length = 294 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -1 Query: 103 ILNQVMWSTFVPFVPNTILPAVISFLLAVTAVLM 2 +L QVMWSTFVP++PN+ILP VISF+ AV AV+M Sbjct: 119 VLPQVMWSTFVPYIPNSILPGVISFVTAVAAVVM 152