BLASTX nr result
ID: Lithospermum22_contig00024374
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00024374 (231 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFI57904.1| cell wall invertase 1 [Prunus persica] 52 3e-07 gb|ABI17893.1| cell-wall invertase [Coffea canephora] 55 8e-06 >gb|AFI57904.1| cell wall invertase 1 [Prunus persica] Length = 577 Score = 52.0 bits (123), Expect(2) = 3e-07 Identities = 22/38 (57%), Positives = 30/38 (78%) Frame = +1 Query: 1 WTDPQMICSQKGASVKGGIGPFGLDYLLSTSTQKIRNV 114 WT+PQ++CS+KGASVKGG+GPFGL L S ++ +V Sbjct: 431 WTNPQLLCSRKGASVKGGLGPFGLLVLASKGLKEYTSV 468 Score = 27.3 bits (59), Expect(2) = 3e-07 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +3 Query: 144 HNTHKEFILFPLLRSSSSLDYEKPTYGAF 230 HN H + RSS + D +K TYGAF Sbjct: 476 HNKHVVLLCSDQSRSSLNKDNDKTTYGAF 504 >gb|ABI17893.1| cell-wall invertase [Coffea canephora] Length = 576 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = +1 Query: 1 WTDPQMICSQKGASVKGGIGPFGLDYLLSTSTQK 102 WTDPQ++CSQKGASV+GG GPFGL L S Q+ Sbjct: 426 WTDPQLLCSQKGASVRGGTGPFGLKVLASKDLQE 459