BLASTX nr result
ID: Lithospermum22_contig00024309
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00024309 (445 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pdb|3VX8|B Chain B, Crystal Structure Of Arabidopsis Thaliana At... 72 6e-11 gb|AFK36423.1| unknown [Medicago truncatula] 72 6e-11 gb|AFK34948.1| unknown [Medicago truncatula] 72 6e-11 ref|XP_003533513.1| PREDICTED: autophagy-related protein 3-like ... 72 6e-11 ref|XP_002866439.1| autophagy 3 [Arabidopsis lyrata subsp. lyrat... 72 6e-11 >pdb|3VX8|B Chain B, Crystal Structure Of Arabidopsis Thaliana Atg7ntd-Atg3 Complex gi|414145391|pdb|3VX8|C Chain C, Crystal Structure Of Arabidopsis Thaliana Atg7ntd-Atg3 Complex Length = 292 Score = 71.6 bits (174), Expect = 6e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 443 EPEVDKYLFLFLKFMASVIPTIEYDYTMDFDLG 345 EPEVDKYLFLFLKFMASVIPTIEYDYTMDFDLG Sbjct: 256 EPEVDKYLFLFLKFMASVIPTIEYDYTMDFDLG 288 >gb|AFK36423.1| unknown [Medicago truncatula] Length = 310 Score = 71.6 bits (174), Expect = 6e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 443 EPEVDKYLFLFLKFMASVIPTIEYDYTMDFDLG 345 EPEVDKYLFLFLKFMASVIPTIEYDYTMDFDLG Sbjct: 274 EPEVDKYLFLFLKFMASVIPTIEYDYTMDFDLG 306 >gb|AFK34948.1| unknown [Medicago truncatula] Length = 310 Score = 71.6 bits (174), Expect = 6e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 443 EPEVDKYLFLFLKFMASVIPTIEYDYTMDFDLG 345 EPEVDKYLFLFLKFMASVIPTIEYDYTMDFDLG Sbjct: 274 EPEVDKYLFLFLKFMASVIPTIEYDYTMDFDLG 306 >ref|XP_003533513.1| PREDICTED: autophagy-related protein 3-like [Glycine max] Length = 272 Score = 71.6 bits (174), Expect = 6e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 443 EPEVDKYLFLFLKFMASVIPTIEYDYTMDFDLG 345 EPEVDKYLFLFLKFMASVIPTIEYDYTMDFDLG Sbjct: 236 EPEVDKYLFLFLKFMASVIPTIEYDYTMDFDLG 268 >ref|XP_002866439.1| autophagy 3 [Arabidopsis lyrata subsp. lyrata] gi|297312274|gb|EFH42698.1| autophagy 3 [Arabidopsis lyrata subsp. lyrata] Length = 313 Score = 71.6 bits (174), Expect = 6e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 443 EPEVDKYLFLFLKFMASVIPTIEYDYTMDFDLG 345 EPEVDKYLFLFLKFMASVIPTIEYDYTMDFDLG Sbjct: 277 EPEVDKYLFLFLKFMASVIPTIEYDYTMDFDLG 309