BLASTX nr result
ID: Lithospermum22_contig00024028
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00024028 (264 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632591.1| PREDICTED: macrophage migration inhibitory f... 98 6e-19 ref|XP_002263560.1| PREDICTED: macrophage migration inhibitory f... 98 6e-19 gb|AFW90560.1| light-inducible protein ATLS1 [Solanum tuberosum] 95 5e-18 gb|ACF06473.1| light-inducible protein ATLS1 [Elaeis guineensis] 95 5e-18 ref|XP_002526685.1| light-inducible protein atls1, putative [Ric... 95 7e-18 >ref|XP_003632591.1| PREDICTED: macrophage migration inhibitory factor homolog isoform 2 [Vitis vinifera] gi|297735608|emb|CBI18102.3| unnamed protein product [Vitis vinifera] Length = 121 Score = 98.2 bits (243), Expect = 6e-19 Identities = 48/54 (88%), Positives = 52/54 (96%) Frame = +3 Query: 102 MPCLNLSTNVSLDGVDSSSILSETTSLVSKILGKPEAYVMIVLKGSVPMAFGGT 263 MPCLNLSTNVSLDGVD+SSILSE TS V+KI+GKPEAYVMIVLKGSVP+AFGGT Sbjct: 1 MPCLNLSTNVSLDGVDTSSILSEATSTVAKIIGKPEAYVMIVLKGSVPIAFGGT 54 >ref|XP_002263560.1| PREDICTED: macrophage migration inhibitory factor homolog isoform 1 [Vitis vinifera] Length = 115 Score = 98.2 bits (243), Expect = 6e-19 Identities = 48/54 (88%), Positives = 52/54 (96%) Frame = +3 Query: 102 MPCLNLSTNVSLDGVDSSSILSETTSLVSKILGKPEAYVMIVLKGSVPMAFGGT 263 MPCLNLSTNVSLDGVD+SSILSE TS V+KI+GKPEAYVMIVLKGSVP+AFGGT Sbjct: 1 MPCLNLSTNVSLDGVDTSSILSEATSTVAKIIGKPEAYVMIVLKGSVPIAFGGT 54 >gb|AFW90560.1| light-inducible protein ATLS1 [Solanum tuberosum] Length = 115 Score = 95.1 bits (235), Expect = 5e-18 Identities = 44/54 (81%), Positives = 52/54 (96%) Frame = +3 Query: 102 MPCLNLSTNVSLDGVDSSSILSETTSLVSKILGKPEAYVMIVLKGSVPMAFGGT 263 MPCLN+STNV+L+GVD+SS+LSE TS V+K++GKPEAYVMIVLKGSVPMAFGGT Sbjct: 1 MPCLNISTNVNLEGVDTSSVLSEATSTVAKLIGKPEAYVMIVLKGSVPMAFGGT 54 >gb|ACF06473.1| light-inducible protein ATLS1 [Elaeis guineensis] Length = 115 Score = 95.1 bits (235), Expect = 5e-18 Identities = 45/54 (83%), Positives = 51/54 (94%) Frame = +3 Query: 102 MPCLNLSTNVSLDGVDSSSILSETTSLVSKILGKPEAYVMIVLKGSVPMAFGGT 263 MPCLNLSTNVSLDGVD+S+ILSE T V+K++GKPEAYVMIVLKGSVPM+FGGT Sbjct: 1 MPCLNLSTNVSLDGVDTSAILSEATKTVAKLIGKPEAYVMIVLKGSVPMSFGGT 54 >ref|XP_002526685.1| light-inducible protein atls1, putative [Ricinus communis] gi|223533985|gb|EEF35707.1| light-inducible protein atls1, putative [Ricinus communis] Length = 115 Score = 94.7 bits (234), Expect = 7e-18 Identities = 46/54 (85%), Positives = 51/54 (94%) Frame = +3 Query: 102 MPCLNLSTNVSLDGVDSSSILSETTSLVSKILGKPEAYVMIVLKGSVPMAFGGT 263 MPCLNLSTNV LDGVD+S+ILSE TS V+KI+GKPEAYVMIVLKGSVP+AFGGT Sbjct: 1 MPCLNLSTNVPLDGVDTSAILSEATSSVAKIIGKPEAYVMIVLKGSVPIAFGGT 54