BLASTX nr result
ID: Lithospermum22_contig00023873
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00023873 (339 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEK71841.1| hypothetical chloroplast RF2 [Acrotrema costatum] 55 4e-06 ref|YP_001468351.1| hypothetical chloroplast RF21 [Ipomoea purpu... 55 4e-06 ref|YP_007317292.1| Ycf2 (chloroplast) [Camellia sinensis] gi|43... 55 6e-06 emb|CAA47848.1| unnamed protein product [Cuscuta reflexa] gi|109... 55 6e-06 gb|AFU96471.1| Ycf2, partial (chloroplast) [Phyllanthus urinaria] 55 6e-06 >gb|AEK71841.1| hypothetical chloroplast RF2 [Acrotrema costatum] Length = 2297 Score = 55.5 bits (132), Expect = 4e-06 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 207 HDLGVNESNYLSLGLLVNHLSSDCGRCS 124 HDL VNESNYLSLGLLVNHLS DC RCS Sbjct: 1761 HDLDVNESNYLSLGLLVNHLSGDCERCS 1788 >ref|YP_001468351.1| hypothetical chloroplast RF21 [Ipomoea purpurea] gi|157325596|ref|YP_001468373.1| hypothetical chloroplast RF21 [Ipomoea purpurea] gi|205412937|sp|A7Y3J6.1|YCF2_IPOPU RecName: Full=Protein ycf2 gi|157056801|gb|ABV02391.1| hypothetical chloroplast RF21 [Ipomoea purpurea] gi|157056824|gb|ABV02414.1| hypothetical chloroplast RF21 [Ipomoea purpurea] Length = 2197 Score = 55.5 bits (132), Expect = 4e-06 Identities = 32/55 (58%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = -1 Query: 285 LAYHLEFLIVRSM-PTICISSGMDYKHHDLGVNESNYLSLGLLVNHLSSDCGRCS 124 L+ L+F + R+M P I + HDL VNESNYLSLGLLVNHLS DC RCS Sbjct: 1631 LSITLQFELARAMSPCIIWIPNI----HDLDVNESNYLSLGLLVNHLSRDCERCS 1681 >ref|YP_007317292.1| Ycf2 (chloroplast) [Camellia sinensis] gi|435856436|ref|YP_007317311.1| Ycf2 (chloroplast) [Camellia sinensis] gi|430728316|gb|AGA55640.1| Ycf2 (chloroplast) [Camellia sinensis] gi|430728335|gb|AGA55659.1| Ycf2 (chloroplast) [Camellia sinensis] Length = 2298 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 207 HDLGVNESNYLSLGLLVNHLSSDCGRCS 124 HDL VNESNYLSLGLLVNHLS DC RCS Sbjct: 1761 HDLDVNESNYLSLGLLVNHLSRDCERCS 1788 >emb|CAA47848.1| unnamed protein product [Cuscuta reflexa] gi|1096968|prf||2113216B ORF 740 Length = 740 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 207 HDLGVNESNYLSLGLLVNHLSSDCGRCS 124 HDL VNESNYLSLGLLVNHLS DC RCS Sbjct: 200 HDLDVNESNYLSLGLLVNHLSRDCERCS 227 >gb|AFU96471.1| Ycf2, partial (chloroplast) [Phyllanthus urinaria] Length = 2559 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 207 HDLGVNESNYLSLGLLVNHLSSDCGRCS 124 HDL VNESNYLSLGLLVNHLS DC RCS Sbjct: 1921 HDLDVNESNYLSLGLLVNHLSRDCERCS 1948