BLASTX nr result
ID: Lithospermum22_contig00023758
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00023758 (233 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272604.1| PREDICTED: uncharacterized protein LOC100258... 66 3e-09 ref|NP_001143717.1| uncharacterized protein LOC100276458 [Zea ma... 64 2e-08 ref|XP_003565674.1| PREDICTED: uncharacterized protein LOC100842... 63 2e-08 gb|EAZ11067.1| hypothetical protein OsJ_00912 [Oryza sativa Japo... 63 3e-08 ref|NP_001042427.1| Os01g0220500 [Oryza sativa Japonica Group] g... 63 3e-08 >ref|XP_002272604.1| PREDICTED: uncharacterized protein LOC100258722 [Vitis vinifera] gi|147843398|emb|CAN82078.1| hypothetical protein VITISV_042760 [Vitis vinifera] gi|297742319|emb|CBI34468.3| unnamed protein product [Vitis vinifera] Length = 95 Score = 66.2 bits (160), Expect = 3e-09 Identities = 35/45 (77%), Positives = 37/45 (82%) Frame = +2 Query: 2 EPGSYKKKFSLAIVDAFPVEISDYQADVLRSIKEVRLVEKNQELA 136 EPGSYKK SL IVD F VEISD QA+VLRS K VR+VEKNQELA Sbjct: 51 EPGSYKKTSSLVIVDGFAVEISDDQANVLRSAKGVRVVEKNQELA 95 >ref|NP_001143717.1| uncharacterized protein LOC100276458 [Zea mays] gi|195625384|gb|ACG34522.1| hypothetical protein [Zea mays] gi|413947779|gb|AFW80428.1| hypothetical protein ZEAMMB73_379679 [Zea mays] Length = 96 Score = 63.5 bits (153), Expect = 2e-08 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = +2 Query: 2 EPGSYKKKFSLAIVDAFPVEISDYQADVLRSIKEVRLVEKNQELA 136 +P SY+K+ SLAIVD F VEI++ QA VLRS KEVR+VEKNQELA Sbjct: 52 QPDSYRKRSSLAIVDGFAVEITEDQASVLRSAKEVRVVEKNQELA 96 >ref|XP_003565674.1| PREDICTED: uncharacterized protein LOC100842221 [Brachypodium distachyon] Length = 96 Score = 63.2 bits (152), Expect = 2e-08 Identities = 32/44 (72%), Positives = 36/44 (81%) Frame = +2 Query: 5 PGSYKKKFSLAIVDAFPVEISDYQADVLRSIKEVRLVEKNQELA 136 P +Y+KK SLAIVD F EI+D QA VLRS KEVR+VEKNQELA Sbjct: 53 PDTYRKKSSLAIVDGFAAEITDAQASVLRSAKEVRVVEKNQELA 96 >gb|EAZ11067.1| hypothetical protein OsJ_00912 [Oryza sativa Japonica Group] Length = 83 Score = 62.8 bits (151), Expect = 3e-08 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = +2 Query: 2 EPGSYKKKFSLAIVDAFPVEISDYQADVLRSIKEVRLVEKNQELA 136 +P +Y+KK SLAIVD F VEI+D QA +LR KEVR+VEKNQELA Sbjct: 39 QPDTYRKKSSLAIVDGFAVEITDAQASILRLAKEVRVVEKNQELA 83 >ref|NP_001042427.1| Os01g0220500 [Oryza sativa Japonica Group] gi|113531958|dbj|BAF04341.1| Os01g0220500 [Oryza sativa Japonica Group] gi|125524942|gb|EAY73056.1| hypothetical protein OsI_00932 [Oryza sativa Indica Group] Length = 95 Score = 62.8 bits (151), Expect = 3e-08 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = +2 Query: 2 EPGSYKKKFSLAIVDAFPVEISDYQADVLRSIKEVRLVEKNQELA 136 +P +Y+KK SLAIVD F VEI+D QA +LR KEVR+VEKNQELA Sbjct: 51 QPDTYRKKSSLAIVDGFAVEITDAQASILRLAKEVRVVEKNQELA 95