BLASTX nr result
ID: Lithospermum22_contig00023727
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00023727 (328 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN74883.1| hypothetical protein VITISV_018571 [Vitis vinifera] 42 6e-06 >emb|CAN74883.1| hypothetical protein VITISV_018571 [Vitis vinifera] Length = 994 Score = 42.4 bits (98), Expect(2) = 6e-06 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -2 Query: 327 PWCDHCQKPDHTKMVCWEV 271 PWCDHC++P HTK CW++ Sbjct: 517 PWCDHCRRPGHTKDTCWKI 535 Score = 32.3 bits (72), Expect(2) = 6e-06 Identities = 27/94 (28%), Positives = 41/94 (43%), Gaps = 4/94 (4%) Frame = -3 Query: 278 GKSNNWTPGRQGGRRSFHNDHRGDSKGGGFQISGGHNGN-TAVTQQREPQILGFIKEQLE 102 GK +W P R F ND G GN ++ ++ P+ F KEQ+E Sbjct: 537 GKPTDWKPSR------FANDKEGQ-------------GNLVSMDEKPSPKPTPFSKEQIE 577 Query: 101 QIQTLLQ---PSPSPSAITGGASCSVVKTGNITS 9 +Q L P+P+P+ + G S+ + GN S Sbjct: 578 VLQKLFSQSLPAPTPTVVGTG---SLAQKGNFLS 608