BLASTX nr result
ID: Lithospermum22_contig00023158
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00023158 (647 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518698.1| copper ion binding protein, putative [Ricinu... 76 5e-12 ref|XP_002522665.1| structural constituent of cell wall, putativ... 76 5e-12 ref|XP_002518697.1| conserved hypothetical protein [Ricinus comm... 76 6e-12 ref|XP_002518696.1| structural constituent of cell wall, putativ... 71 2e-10 ref|XP_004173043.1| PREDICTED: uncharacterized LOC101217259 [Cuc... 69 7e-10 >ref|XP_002518698.1| copper ion binding protein, putative [Ricinus communis] gi|223542079|gb|EEF43623.1| copper ion binding protein, putative [Ricinus communis] Length = 619 Score = 76.3 bits (186), Expect = 5e-12 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -3 Query: 177 KTVKCQNKYYPQCYNVKHTCPGTCPQGCEIDCVTCKP 67 KT KC+NK+YPQCYN +H CP +CP GCE+DC+TCKP Sbjct: 321 KTAKCRNKHYPQCYNTEHVCPSSCPGGCEVDCITCKP 357 >ref|XP_002522665.1| structural constituent of cell wall, putative [Ricinus communis] gi|223538141|gb|EEF39752.1| structural constituent of cell wall, putative [Ricinus communis] Length = 535 Score = 76.3 bits (186), Expect = 5e-12 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 177 KTVKCQNKYYPQCYNVKHTCPGTCPQGCEIDCVTCKP 67 KT KC+N+YYPQCYN +H CP +CP GCE+DCVTCKP Sbjct: 237 KTAKCRNEYYPQCYNSEHVCPSSCPGGCEVDCVTCKP 273 >ref|XP_002518697.1| conserved hypothetical protein [Ricinus communis] gi|223542078|gb|EEF43622.1| conserved hypothetical protein [Ricinus communis] Length = 288 Score = 75.9 bits (185), Expect = 6e-12 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 177 KTVKCQNKYYPQCYNVKHTCPGTCPQGCEIDCVTCKP 67 KT KC+NK+YPQCYN +H CP +CP GCE+DCVTCKP Sbjct: 121 KTAKCRNKHYPQCYNTEHVCPRSCPGGCEVDCVTCKP 157 >ref|XP_002518696.1| structural constituent of cell wall, putative [Ricinus communis] gi|223542077|gb|EEF43621.1| structural constituent of cell wall, putative [Ricinus communis] Length = 558 Score = 71.2 bits (173), Expect = 2e-10 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = -3 Query: 177 KTVKCQNKYYPQCYNVKHTCPGTCPQGCEIDCVTCKP 67 KT KC+NK Y QCYN +H CP +CP GCE+DCVTCKP Sbjct: 260 KTAKCRNKNYTQCYNSEHVCPSSCPGGCEVDCVTCKP 296 >ref|XP_004173043.1| PREDICTED: uncharacterized LOC101217259 [Cucumis sativus] Length = 579 Score = 68.9 bits (167), Expect = 7e-10 Identities = 24/37 (64%), Positives = 29/37 (78%) Frame = -3 Query: 177 KTVKCQNKYYPQCYNVKHTCPGTCPQGCEIDCVTCKP 67 K V+C+N YPQCYN+ H CP CP GC++DCVTCKP Sbjct: 302 KRVRCKNAKYPQCYNMIHNCPSACPNGCQVDCVTCKP 338