BLASTX nr result
ID: Lithospermum22_contig00022892
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00022892 (1030 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512034.1| conserved hypothetical protein [Ricinus comm... 62 3e-07 emb|CBI27324.3| unnamed protein product [Vitis vinifera] 61 5e-07 ref|XP_003520133.1| PREDICTED: uncharacterized protein LOC100778... 60 1e-06 ref|XP_002312345.1| predicted protein [Populus trichocarpa] gi|2... 59 1e-06 ref|XP_002514618.1| hypothetical protein RCOM_1467930 [Ricinus c... 59 3e-06 >ref|XP_002512034.1| conserved hypothetical protein [Ricinus communis] gi|223549214|gb|EEF50703.1| conserved hypothetical protein [Ricinus communis] Length = 632 Score = 61.6 bits (148), Expect = 3e-07 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +2 Query: 779 KRALFAFHPDRFSRADVRHQLQAEEKFKLISRMKQKY 889 KRAL FHPDR SR D+R Q++AEEKFKLISRMKQK+ Sbjct: 590 KRALLKFHPDRASRTDIRQQVEAEEKFKLISRMKQKF 626 >emb|CBI27324.3| unnamed protein product [Vitis vinifera] Length = 620 Score = 60.8 bits (146), Expect = 5e-07 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +2 Query: 779 KRALFAFHPDRFSRADVRHQLQAEEKFKLISRMKQKY 889 KRAL FHPDR SR D+ HQ++AEEKFKLISRMK+K+ Sbjct: 580 KRALLKFHPDRASRTDIYHQVEAEEKFKLISRMKEKF 616 >ref|XP_003520133.1| PREDICTED: uncharacterized protein LOC100778452 [Glycine max] Length = 555 Score = 59.7 bits (143), Expect = 1e-06 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = +2 Query: 779 KRALFAFHPDRFSRADVRHQLQAEEKFKLISRMKQKYNM 895 KRAL FHPDR S+ DVR Q++AEEKFKLISR+K+K+ M Sbjct: 513 KRALLKFHPDRASKTDVRAQVEAEEKFKLISRLKEKFGM 551 >ref|XP_002312345.1| predicted protein [Populus trichocarpa] gi|222852165|gb|EEE89712.1| predicted protein [Populus trichocarpa] Length = 116 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = +2 Query: 779 KRALFAFHPDRFSRADVRHQLQAEEKFKLISRMKQKY 889 KRAL FHPDR S+ D+R Q++AEEKFKLISRMK+K+ Sbjct: 74 KRALLKFHPDRASKTDIRRQVEAEEKFKLISRMKEKF 110 >ref|XP_002514618.1| hypothetical protein RCOM_1467930 [Ricinus communis] gi|223546222|gb|EEF47724.1| hypothetical protein RCOM_1467930 [Ricinus communis] Length = 451 Score = 58.5 bits (140), Expect = 3e-06 Identities = 27/50 (54%), Positives = 39/50 (78%), Gaps = 1/50 (2%) Frame = +2 Query: 743 GLFTRNSDFRLS-KRALFAFHPDRFSRADVRHQLQAEEKFKLISRMKQKY 889 G + +++ R + K+AL FHPDR SR+D+R Q++AEEKFKLISR K+K+ Sbjct: 400 GFYPSSTEVRTAYKQALLRFHPDRASRSDIRQQIEAEEKFKLISRAKEKF 449