BLASTX nr result
ID: Lithospermum22_contig00022884
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00022884 (436 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN64497.1| hypothetical protein VITISV_004037 [Vitis vinifera] 56 3e-06 >emb|CAN64497.1| hypothetical protein VITISV_004037 [Vitis vinifera] Length = 480 Score = 55.8 bits (133), Expect = 3e-06 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = +3 Query: 198 QSKASSHAVST*RTILSPFTKEYRVCAAFSGIRLFL 305 QSK+ S AVST RTILSPFTKEYRV AA SGIRLFL Sbjct: 12 QSKSRSRAVSTKRTILSPFTKEYRVRAASSGIRLFL 47