BLASTX nr result
ID: Lithospermum22_contig00022555
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00022555 (264 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588268.1| NADH-ubiquinone oxidoreductase chain [Medica... 74 9e-12 ref|XP_002451896.1| hypothetical protein SORBIDRAFT_04g009491 [S... 70 7e-11 emb|CAN71467.1| hypothetical protein VITISV_038988 [Vitis vinifera] 58 2e-10 >ref|XP_003588268.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] gi|355477316|gb|AES58519.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] Length = 556 Score = 74.3 bits (181), Expect = 9e-12 Identities = 43/88 (48%), Positives = 46/88 (52%) Frame = +1 Query: 1 FRAASRPGPTGGHLSQGKHYCSPPPEKQKIGESRRKIHA*IVV*CQGRRRKLGTEPYEAE 180 FRA S PGPTGGHL Q K +CSPPP+KQKI ES Sbjct: 285 FRARSGPGPTGGHLPQRKLHCSPPPDKQKIRES--------------------------- 317 Query: 181 VSRTVL*EGSGYLLELRPTTTGQFRFGA 264 SGYLLELRPTTTG+FRFGA Sbjct: 318 ---------SGYLLELRPTTTGKFRFGA 336 >ref|XP_002451896.1| hypothetical protein SORBIDRAFT_04g009491 [Sorghum bicolor] gi|241931727|gb|EES04872.1| hypothetical protein SORBIDRAFT_04g009491 [Sorghum bicolor] Length = 289 Score = 70.5 bits (171), Expect(2) = 7e-11 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = -2 Query: 119 YACIFRLDSPIFCFSGGGEQ*CLPCDKCPPVGPGLLAAR 3 YAC+FRLDS IFCFSGGGEQ L C +CPPVGPGLL AR Sbjct: 239 YACLFRLDSRIFCFSGGGEQCSLRCGRCPPVGPGLLPAR 277 Score = 21.2 bits (43), Expect(2) = 7e-11 Identities = 6/10 (60%), Positives = 9/10 (90%) Frame = -1 Query: 138 LALDHYLCMY 109 L+LDHY C++ Sbjct: 234 LSLDHYACLF 243 >emb|CAN71467.1| hypothetical protein VITISV_038988 [Vitis vinifera] Length = 280 Score = 57.8 bits (138), Expect(2) = 2e-10 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = -2 Query: 101 LDSPIFCFSGGGEQ*CLPCDKCPPVGPGLLAAR 3 LDS IFCFSGGGEQ L C +CPPVGPGLL AR Sbjct: 52 LDSRIFCFSGGGEQCSLRCGRCPPVGPGLLPAR 84 Score = 32.3 bits (72), Expect(2) = 2e-10 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 261 PKAELTGGGWSKL 223 PKAELTGGGWSKL Sbjct: 38 PKAELTGGGWSKL 50