BLASTX nr result
ID: Lithospermum22_contig00022445
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00022445 (241 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEL99054.1| pre-mRNA-splicing factor, partial [Silene latifolia] 55 6e-06 gb|AEL99053.1| pre-mRNA-splicing factor, partial [Silene latifolia] 55 6e-06 >gb|AEL99054.1| pre-mRNA-splicing factor, partial [Silene latifolia] Length = 426 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -1 Query: 100 MAEVQTSGRPIDQCLEKVLCMNILSSEYFRDL 5 M ++QTSG+PID +EKVLCMNILSS+YFRDL Sbjct: 1 MGDLQTSGKPIDSLVEKVLCMNILSSDYFRDL 32 >gb|AEL99053.1| pre-mRNA-splicing factor, partial [Silene latifolia] Length = 426 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -1 Query: 100 MAEVQTSGRPIDQCLEKVLCMNILSSEYFRDL 5 M ++QTSG+PID +EKVLCMNILSS+YFRDL Sbjct: 1 MGDLQTSGKPIDSLVEKVLCMNILSSDYFRDL 32