BLASTX nr result
ID: Lithospermum22_contig00022359
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00022359 (649 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525659.1| conserved hypothetical protein [Ricinus comm... 59 1e-06 >ref|XP_002525659.1| conserved hypothetical protein [Ricinus communis] gi|223535095|gb|EEF36777.1| conserved hypothetical protein [Ricinus communis] Length = 91 Score = 58.5 bits (140), Expect = 1e-06 Identities = 31/52 (59%), Positives = 36/52 (69%) Frame = -3 Query: 599 CLFLAFAMICSARNTISISGDGIMNLRFGGRSLKMSLDDYGEASANSGHDPK 444 CL L FA++ SARN I IS +GI L GRSLK L+DY E SAN GHDP+ Sbjct: 10 CLLLVFALLSSARNPIPISENGIA-LANTGRSLKAMLNDYSEPSANQGHDPR 60