BLASTX nr result
ID: Lithospermum22_contig00022244
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00022244 (453 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACT33043.1| RAV transcription factor [Camellia sinensis] 65 7e-09 ref|XP_002524409.1| DNA-binding protein RAV1, putative [Ricinus ... 61 8e-08 gb|AFH57270.1| RAV [Gossypium hirsutum] 57 2e-06 >gb|ACT33043.1| RAV transcription factor [Camellia sinensis] Length = 362 Score = 64.7 bits (156), Expect = 7e-09 Identities = 32/49 (65%), Positives = 38/49 (77%) Frame = -3 Query: 448 LVQPVQVVRLFGVNIFKAPHQVVMESVDVSCSGKRSREMELLAMECIKK 302 +VQPVQ+VRLFGVNIFK P + +D +C GKR REMELLA+EC KK Sbjct: 310 VVQPVQMVRLFGVNIFKVP---ISGGLDSNCGGKRMREMELLALECSKK 355 >ref|XP_002524409.1| DNA-binding protein RAV1, putative [Ricinus communis] gi|223536370|gb|EEF38020.1| DNA-binding protein RAV1, putative [Ricinus communis] Length = 371 Score = 61.2 bits (147), Expect = 8e-08 Identities = 31/48 (64%), Positives = 37/48 (77%) Frame = -3 Query: 445 VQPVQVVRLFGVNIFKAPHQVVMESVDVSCSGKRSREMELLAMECIKK 302 VQPVQ+VRLFGVNIFK P +E C+GKR REMELL+++CIKK Sbjct: 321 VQPVQMVRLFGVNIFKVPGNSHIE----GCNGKRIREMELLSLDCIKK 364 >gb|AFH57270.1| RAV [Gossypium hirsutum] Length = 357 Score = 56.6 bits (135), Expect = 2e-06 Identities = 31/51 (60%), Positives = 38/51 (74%), Gaps = 2/51 (3%) Frame = -3 Query: 448 LVQPVQVVRLFGVNIFKAPHQVVMESVDVS--CSGKRSREMELLAMECIKK 302 L PVQ+VRLFGVNIFK P E+V ++ C+GKR+REMELL +EC KK Sbjct: 303 LENPVQMVRLFGVNIFKMPGS---ENVGLAGGCNGKRTREMELLELECSKK 350