BLASTX nr result
ID: Lithospermum22_contig00022184
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00022184 (374 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271534.2| PREDICTED: BTB/POZ and MATH domain-containin... 83 3e-14 emb|CBI32329.3| unnamed protein product [Vitis vinifera] 83 3e-14 ref|NP_974236.1| BTB/POZ and M2 domain-containing protein [Arabi... 82 5e-14 ref|XP_002884563.1| ATBPM2 [Arabidopsis lyrata subsp. lyrata] gi... 82 5e-14 ref|NP_566275.1| BTB/POZ and M2 domain-containing protein [Arabi... 82 5e-14 >ref|XP_002271534.2| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Vitis vinifera] Length = 489 Score = 82.8 bits (203), Expect = 3e-14 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -1 Query: 122 HDFKITGYSLSKGMGVGKYIASDTFMVGGYGWAVYFYPDG 3 H FKITGYSLSKG+G+GKYIASDTF+VGGY WA+YFYPDG Sbjct: 32 HQFKITGYSLSKGLGIGKYIASDTFVVGGYAWAIYFYPDG 71 >emb|CBI32329.3| unnamed protein product [Vitis vinifera] Length = 402 Score = 82.8 bits (203), Expect = 3e-14 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -1 Query: 122 HDFKITGYSLSKGMGVGKYIASDTFMVGGYGWAVYFYPDG 3 H FKITGYSLSKG+G+GKYIASDTF+VGGY WA+YFYPDG Sbjct: 32 HQFKITGYSLSKGLGIGKYIASDTFVVGGYAWAIYFYPDG 71 >ref|NP_974236.1| BTB/POZ and M2 domain-containing protein [Arabidopsis thaliana] gi|332640838|gb|AEE74359.1| BTB/POZ and M2 domain-containing protein [Arabidopsis thaliana] Length = 295 Score = 82.0 bits (201), Expect = 5e-14 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = -1 Query: 122 HDFKITGYSLSKGMGVGKYIASDTFMVGGYGWAVYFYPDG 3 H+FKI+GYSL KGMG+GKY+ASDTFMVGGY WA+YFYPDG Sbjct: 35 HEFKISGYSLVKGMGIGKYVASDTFMVGGYSWAIYFYPDG 74 >ref|XP_002884563.1| ATBPM2 [Arabidopsis lyrata subsp. lyrata] gi|297330403|gb|EFH60822.1| ATBPM2 [Arabidopsis lyrata subsp. lyrata] Length = 406 Score = 82.0 bits (201), Expect = 5e-14 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = -1 Query: 122 HDFKITGYSLSKGMGVGKYIASDTFMVGGYGWAVYFYPDG 3 H+FKI+GYSL KGMG+GKY+ASDTFMVGGY WA+YFYPDG Sbjct: 35 HEFKISGYSLVKGMGIGKYVASDTFMVGGYSWAIYFYPDG 74 >ref|NP_566275.1| BTB/POZ and M2 domain-containing protein [Arabidopsis thaliana] gi|75312287|sp|Q9M8J9.1|BPM2_ARATH RecName: Full=BTB/POZ and MATH domain-containing protein 2; AltName: Full=Protein BTB-POZ AND MATH DOMAIN 2; Short=AtBPM2 gi|6862923|gb|AAF30312.1|AC018907_12 unknown protein [Arabidopsis thaliana] gi|15028069|gb|AAK76565.1| unknown protein [Arabidopsis thaliana] gi|20259305|gb|AAM14388.1| unknown protein [Arabidopsis thaliana] gi|332640837|gb|AEE74358.1| BTB/POZ and M2 domain-containing protein [Arabidopsis thaliana] Length = 406 Score = 82.0 bits (201), Expect = 5e-14 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = -1 Query: 122 HDFKITGYSLSKGMGVGKYIASDTFMVGGYGWAVYFYPDG 3 H+FKI+GYSL KGMG+GKY+ASDTFMVGGY WA+YFYPDG Sbjct: 35 HEFKISGYSLVKGMGIGKYVASDTFMVGGYSWAIYFYPDG 74