BLASTX nr result
ID: Lithospermum22_contig00022158
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00022158 (367 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002263208.1| PREDICTED: TIM21-like protein, mitochondrial... 61 8e-08 ref|XP_004159453.1| PREDICTED: uncharacterized LOC101212713 [Cuc... 60 1e-07 ref|XP_004140920.1| PREDICTED: uncharacterized protein LOC101212... 60 1e-07 >ref|XP_002263208.1| PREDICTED: TIM21-like protein, mitochondrial [Vitis vinifera] gi|296088479|emb|CBI37470.3| unnamed protein product [Vitis vinifera] Length = 314 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 3 DSVDKQWKFMYLIVEVKSPTPAQLMLESYVPA 98 D VDKQWKF YLI E+KSP+PAQLMLESYVPA Sbjct: 283 DKVDKQWKFTYLIAEIKSPSPAQLMLESYVPA 314 >ref|XP_004159453.1| PREDICTED: uncharacterized LOC101212713 [Cucumis sativus] Length = 323 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 3 DSVDKQWKFMYLIVEVKSPTPAQLMLESYVPA 98 D VDKQWKF YLIVEVKSP+PAQL+LESY+PA Sbjct: 292 DQVDKQWKFTYLIVEVKSPSPAQLILESYMPA 323 >ref|XP_004140920.1| PREDICTED: uncharacterized protein LOC101212713 [Cucumis sativus] Length = 323 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 3 DSVDKQWKFMYLIVEVKSPTPAQLMLESYVPA 98 D VDKQWKF YLIVEVKSP+PAQL+LESY+PA Sbjct: 292 DQVDKQWKFTYLIVEVKSPSPAQLILESYMPA 323