BLASTX nr result
ID: Lithospermum22_contig00022140
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00022140 (777 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004144336.1| PREDICTED: SPX and EXS domain-containing pro... 98 2e-18 ref|XP_002327841.1| predicted small molecule transporter [Populu... 92 1e-16 ref|XP_002515726.1| conserved hypothetical protein [Ricinus comm... 90 5e-16 ref|XP_003552368.1| PREDICTED: SPX and EXS domain-containing pro... 89 1e-15 ref|XP_003533623.1| PREDICTED: SPX and EXS domain-containing pro... 89 1e-15 >ref|XP_004144336.1| PREDICTED: SPX and EXS domain-containing protein 1-like [Cucumis sativus] gi|449480887|ref|XP_004156022.1| PREDICTED: SPX and EXS domain-containing protein 1-like [Cucumis sativus] Length = 477 Score = 98.2 bits (243), Expect = 2e-18 Identities = 44/65 (67%), Positives = 55/65 (84%) Frame = -3 Query: 775 AHLRHNYITLFTITALEILRRFQWVYFRVENEWSKMTNKPQNASISMEEIPIEEQKLLNS 596 AHLRHNY+T+FTITALEI RRFQW++FRVENEW+KM +K N I+M +P EE KLLNS Sbjct: 414 AHLRHNYLTVFTITALEIFRRFQWIFFRVENEWNKMNSK-SNIQITMSNLPTEEDKLLNS 472 Query: 595 NDHSV 581 ++H+V Sbjct: 473 SNHNV 477 >ref|XP_002327841.1| predicted small molecule transporter [Populus trichocarpa] gi|222837250|gb|EEE75629.1| predicted small molecule transporter [Populus trichocarpa] Length = 465 Score = 92.4 bits (228), Expect = 1e-16 Identities = 42/65 (64%), Positives = 55/65 (84%) Frame = -3 Query: 775 AHLRHNYITLFTITALEILRRFQWVYFRVENEWSKMTNKPQNASISMEEIPIEEQKLLNS 596 AHLRHNY+T+FTITALE++RRFQWV+FRVENEW+KM++K +++ + EI EE KLL Sbjct: 404 AHLRHNYLTVFTITALEMIRRFQWVFFRVENEWNKMSSK---SNLQLSEISSEEDKLLAP 460 Query: 595 NDHSV 581 NDH+V Sbjct: 461 NDHNV 465 >ref|XP_002515726.1| conserved hypothetical protein [Ricinus communis] gi|223545163|gb|EEF46673.1| conserved hypothetical protein [Ricinus communis] Length = 473 Score = 90.1 bits (222), Expect = 5e-16 Identities = 42/65 (64%), Positives = 53/65 (81%) Frame = -3 Query: 775 AHLRHNYITLFTITALEILRRFQWVYFRVENEWSKMTNKPQNASISMEEIPIEEQKLLNS 596 AHLRHNY+T+F ITALE++RRFQWV+FRVENEW+KMT+K + + M EI EE KLL Sbjct: 410 AHLRHNYLTVFAITALEMVRRFQWVFFRVENEWNKMTSK-SSIQLQMNEISSEEAKLLVP 468 Query: 595 NDHSV 581 +DH+V Sbjct: 469 SDHNV 473 >ref|XP_003552368.1| PREDICTED: SPX and EXS domain-containing protein 1-like [Glycine max] Length = 420 Score = 89.0 bits (219), Expect = 1e-15 Identities = 41/65 (63%), Positives = 51/65 (78%) Frame = -3 Query: 775 AHLRHNYITLFTITALEILRRFQWVYFRVENEWSKMTNKPQNASISMEEIPIEEQKLLNS 596 AHLRHNY+T+FTIT LE+ RRFQWV+FRVENEW+K+T + + + EIP EE+KLL S Sbjct: 360 AHLRHNYLTVFTITLLEMFRRFQWVFFRVENEWNKIT----RSGVQLTEIPREEEKLLGS 415 Query: 595 NDHSV 581 N H V Sbjct: 416 NIHDV 420 >ref|XP_003533623.1| PREDICTED: SPX and EXS domain-containing protein 1-like [Glycine max] Length = 420 Score = 89.0 bits (219), Expect = 1e-15 Identities = 41/65 (63%), Positives = 51/65 (78%) Frame = -3 Query: 775 AHLRHNYITLFTITALEILRRFQWVYFRVENEWSKMTNKPQNASISMEEIPIEEQKLLNS 596 AHLRHNY+T+FTIT LE+ RRFQWV+FRVENEW+K+T + + + EIP EE+KLL S Sbjct: 360 AHLRHNYLTVFTITLLEMFRRFQWVFFRVENEWNKIT----RSGVQLTEIPREEEKLLGS 415 Query: 595 NDHSV 581 N H V Sbjct: 416 NIHDV 420