BLASTX nr result
ID: Lithospermum22_contig00021828
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00021828 (388 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAG12703.1|AC021046_4 acid phosphatase, putative; 5376-6903 [... 62 5e-08 dbj|BAD43737.1| putative sterol desaturase [Arabidopsis thaliana] 62 5e-08 ref|XP_002888727.1| hypothetical protein ARALYDRAFT_476099 [Arab... 62 5e-08 ref|NP_177122.2| sphingoid base hydroxylase 1 [Arabidopsis thali... 62 5e-08 ref|XP_002890629.1| hypothetical protein ARALYDRAFT_890035 [Arab... 60 2e-07 >gb|AAG12703.1|AC021046_4 acid phosphatase, putative; 5376-6903 [Arabidopsis thaliana] gi|12325199|gb|AAG52550.1|AC013289_17 putative sterol desaturase; 75442-76969 [Arabidopsis thaliana] Length = 258 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 386 WDKILGTYMPYSLEKRADGGFEARPTKECK 297 WD+ILGTYMPYSLEKR DGGFEARPTKE K Sbjct: 227 WDRILGTYMPYSLEKREDGGFEARPTKEFK 256 >dbj|BAD43737.1| putative sterol desaturase [Arabidopsis thaliana] Length = 64 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 386 WDKILGTYMPYSLEKRADGGFEARPTKECK 297 WD+ILGTYMPYSLEKR DGGFEARPTKE K Sbjct: 33 WDRILGTYMPYSLEKREDGGFEARPTKEFK 62 >ref|XP_002888727.1| hypothetical protein ARALYDRAFT_476099 [Arabidopsis lyrata subsp. lyrata] gi|297334568|gb|EFH64986.1| hypothetical protein ARALYDRAFT_476099 [Arabidopsis lyrata subsp. lyrata] Length = 258 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 386 WDKILGTYMPYSLEKRADGGFEARPTKECK 297 WD+ILGTYMPYSLEKR DGGFEARPTKE K Sbjct: 227 WDRILGTYMPYSLEKREDGGFEARPTKEFK 256 >ref|NP_177122.2| sphingoid base hydroxylase 1 [Arabidopsis thaliana] gi|75248486|sp|Q8VYI1.1|SBH1_ARATH RecName: Full=Sphinganine C(4)-monooxygenase 1; AltName: Full=Sphingoid C4-hydroxylase 1; AltName: Full=Sphingoid base hydroxylase 1 gi|17979535|gb|AAL50102.1| At1g69640/F24J1.22 [Arabidopsis thaliana] gi|23505995|gb|AAN28857.1| At1g69640/F24J1.22 [Arabidopsis thaliana] gi|332196837|gb|AEE34958.1| sphingoid base hydroxylase 1 [Arabidopsis thaliana] Length = 260 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 386 WDKILGTYMPYSLEKRADGGFEARPTKECK 297 WD+ILGTYMPYSLEKR DGGFEARPTKE K Sbjct: 229 WDRILGTYMPYSLEKREDGGFEARPTKEFK 258 >ref|XP_002890629.1| hypothetical protein ARALYDRAFT_890035 [Arabidopsis lyrata subsp. lyrata] gi|297336471|gb|EFH66888.1| hypothetical protein ARALYDRAFT_890035 [Arabidopsis lyrata subsp. lyrata] Length = 266 Score = 60.1 bits (144), Expect = 2e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 386 WDKILGTYMPYSLEKRADGGFEARPTKECK 297 WD+ILGTYMPYSLEKR DGGFEARPTK+ + Sbjct: 236 WDRILGTYMPYSLEKRKDGGFEARPTKQVR 265