BLASTX nr result
ID: Lithospermum22_contig00021748
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00021748 (454 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI15583.3| unnamed protein product [Vitis vinifera] 77 1e-12 ref|XP_002282611.1| PREDICTED: protein sel-1 homolog 2 [Vitis vi... 77 1e-12 ref|XP_003530964.1| PREDICTED: protein sel-1 homolog 2-like [Gly... 76 2e-12 ref|NP_001236914.1| SEL-1 precursor [Glycine max] gi|68131077|db... 76 2e-12 ref|XP_002530478.1| conserved hypothetical protein [Ricinus comm... 75 6e-12 >emb|CBI15583.3| unnamed protein product [Vitis vinifera] Length = 576 Score = 77.0 bits (188), Expect = 1e-12 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = -3 Query: 452 SLPEVYPKVEAWIENVLLEEGNATILTLFVCLLTVLYL 339 SLPEVYPKVEAW+ENV++EEGNATILTLFVCLLTVLYL Sbjct: 509 SLPEVYPKVEAWVENVIMEEGNATILTLFVCLLTVLYL 546 >ref|XP_002282611.1| PREDICTED: protein sel-1 homolog 2 [Vitis vinifera] Length = 674 Score = 77.0 bits (188), Expect = 1e-12 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = -3 Query: 452 SLPEVYPKVEAWIENVLLEEGNATILTLFVCLLTVLYL 339 SLPEVYPKVEAW+ENV++EEGNATILTLFVCLLTVLYL Sbjct: 607 SLPEVYPKVEAWVENVIMEEGNATILTLFVCLLTVLYL 644 >ref|XP_003530964.1| PREDICTED: protein sel-1 homolog 2-like [Glycine max] Length = 671 Score = 76.3 bits (186), Expect = 2e-12 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = -3 Query: 452 SLPEVYPKVEAWIENVLLEEGNATILTLFVCLLTVLYL 339 SLPE+YPK+EAW+ENVLLEEGNATILTLFVCLLTVLYL Sbjct: 606 SLPELYPKLEAWVENVLLEEGNATILTLFVCLLTVLYL 643 >ref|NP_001236914.1| SEL-1 precursor [Glycine max] gi|68131077|dbj|BAE02648.1| SEL-1 [Glycine max] Length = 670 Score = 76.3 bits (186), Expect = 2e-12 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = -3 Query: 452 SLPEVYPKVEAWIENVLLEEGNATILTLFVCLLTVLYL 339 SLPE+YPK+EAW+ENVLLEEGNATILTLFVCLLTVLYL Sbjct: 602 SLPELYPKLEAWVENVLLEEGNATILTLFVCLLTVLYL 639 >ref|XP_002530478.1| conserved hypothetical protein [Ricinus communis] gi|223529975|gb|EEF31901.1| conserved hypothetical protein [Ricinus communis] Length = 681 Score = 75.1 bits (183), Expect = 6e-12 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -3 Query: 452 SLPEVYPKVEAWIENVLLEEGNATILTLFVCLLTVLYL 339 SLP VYPKVEAW+ENV+LEEGNATILTLFVCLLTVLYL Sbjct: 615 SLPGVYPKVEAWVENVILEEGNATILTLFVCLLTVLYL 652