BLASTX nr result
ID: Lithospermum22_contig00021717
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00021717 (319 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278192.1| PREDICTED: BTB/POZ and TAZ domain-containing... 84 5e-24 emb|CBI14900.3| unnamed protein product [Vitis vinifera] 84 5e-24 ref|XP_002511276.1| protein binding protein, putative [Ricinus c... 81 2e-23 ref|XP_002318693.1| predicted protein [Populus trichocarpa] gi|2... 77 3e-23 ref|XP_002322214.1| predicted protein [Populus trichocarpa] gi|2... 77 3e-23 >ref|XP_002278192.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Vitis vinifera] Length = 351 Score = 83.6 bits (205), Expect(2) = 5e-24 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = -1 Query: 127 EAMECLEHICTEGCTSVGPYDMEPGVKKGPCNKFSTCQGLQL 2 EAMECLEHICTEGCTSVGPY +EP KKGPC KFSTC GLQ+ Sbjct: 206 EAMECLEHICTEGCTSVGPYHLEPTTKKGPCGKFSTCHGLQM 247 Score = 52.4 bits (124), Expect(2) = 5e-24 Identities = 23/39 (58%), Positives = 32/39 (82%) Frame = -3 Query: 317 FLQDNDPWLQLEILHFMDEAASRKKRAKRHMREQNIYLQ 201 FLQD+DP L+LEI+ FM+E+ SRKKR++R E+ +YLQ Sbjct: 165 FLQDHDPHLELEIMQFMEESESRKKRSRRRREERCLYLQ 203 >emb|CBI14900.3| unnamed protein product [Vitis vinifera] Length = 347 Score = 83.6 bits (205), Expect(2) = 5e-24 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = -1 Query: 127 EAMECLEHICTEGCTSVGPYDMEPGVKKGPCNKFSTCQGLQL 2 EAMECLEHICTEGCTSVGPY +EP KKGPC KFSTC GLQ+ Sbjct: 202 EAMECLEHICTEGCTSVGPYHLEPTTKKGPCGKFSTCHGLQM 243 Score = 52.4 bits (124), Expect(2) = 5e-24 Identities = 23/39 (58%), Positives = 32/39 (82%) Frame = -3 Query: 317 FLQDNDPWLQLEILHFMDEAASRKKRAKRHMREQNIYLQ 201 FLQD+DP L+LEI+ FM+E+ SRKKR++R E+ +YLQ Sbjct: 161 FLQDHDPHLELEIMQFMEESESRKKRSRRRREERCLYLQ 199 >ref|XP_002511276.1| protein binding protein, putative [Ricinus communis] gi|223550391|gb|EEF51878.1| protein binding protein, putative [Ricinus communis] Length = 363 Score = 81.3 bits (199), Expect(2) = 2e-23 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = -1 Query: 124 AMECLEHICTEGCTSVGPYDMEPGVKKGPCNKFSTCQGLQL 2 AM+CLEHICTEGCTSVGPYD++P K+ PCNKFSTCQGLQL Sbjct: 220 AMDCLEHICTEGCTSVGPYDVQPTKKRVPCNKFSTCQGLQL 260 Score = 52.8 bits (125), Expect(2) = 2e-23 Identities = 21/39 (53%), Positives = 33/39 (84%) Frame = -3 Query: 317 FLQDNDPWLQLEILHFMDEAASRKKRAKRHMREQNIYLQ 201 F+Q++DP+L+ EIL F+DEA RKKR +RH +EQ++Y++ Sbjct: 178 FMQNHDPFLEYEILQFIDEAELRKKRTRRHRQEQSLYME 216 >ref|XP_002318693.1| predicted protein [Populus trichocarpa] gi|222859366|gb|EEE96913.1| predicted protein [Populus trichocarpa] Length = 364 Score = 76.6 bits (187), Expect(2) = 3e-23 Identities = 34/43 (79%), Positives = 38/43 (88%), Gaps = 1/43 (2%) Frame = -1 Query: 127 EAMECLEHICTEGCTSVGPYDMEPGVK-KGPCNKFSTCQGLQL 2 EAMECLEHICTEGCT+VGP D+ P K +GPCNKFSTC+GLQL Sbjct: 220 EAMECLEHICTEGCTTVGPCDLGPSNKRRGPCNKFSTCEGLQL 262 Score = 57.0 bits (136), Expect(2) = 3e-23 Identities = 23/39 (58%), Positives = 33/39 (84%) Frame = -3 Query: 317 FLQDNDPWLQLEILHFMDEAASRKKRAKRHMREQNIYLQ 201 F+Q+NDP+L+LEIL F+DEA SRKKR +RH EQ ++++ Sbjct: 179 FMQENDPFLELEILRFIDEAESRKKRTRRHREEQRLFME 217 >ref|XP_002322214.1| predicted protein [Populus trichocarpa] gi|222869210|gb|EEF06341.1| predicted protein [Populus trichocarpa] Length = 344 Score = 77.4 bits (189), Expect(2) = 3e-23 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = -1 Query: 127 EAMECLEHICTEGCTSVGPYDMEPGVKKGPCNKFSTCQGLQL 2 EAMECLEHICTEGCT+VGP D+EP K+ PC+KFS C+GLQL Sbjct: 201 EAMECLEHICTEGCTTVGPCDLEPSKKRDPCDKFSICEGLQL 242 Score = 55.8 bits (133), Expect(2) = 3e-23 Identities = 23/39 (58%), Positives = 32/39 (82%) Frame = -3 Query: 317 FLQDNDPWLQLEILHFMDEAASRKKRAKRHMREQNIYLQ 201 F+ +NDP+L+LEIL F+DEA SRK RA+RH EQ +Y++ Sbjct: 160 FMHENDPFLELEILQFIDEAESRKMRARRHREEQRLYME 198