BLASTX nr result
ID: Lithospermum22_contig00021491
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00021491 (385 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003612059.1| Soluble inorganic pyrophosphatase [Medicago ... 60 2e-07 ref|XP_003612057.1| Soluble inorganic pyrophosphatase [Medicago ... 60 2e-07 gb|AFW74916.1| hypothetical protein ZEAMMB73_605071 [Zea mays] 60 2e-07 gb|AFW74913.1| hypothetical protein ZEAMMB73_875183 [Zea mays] 60 2e-07 gb|ACF74329.1| putative inorganic pyrophosphatase [Arachis hypog... 57 2e-06 >ref|XP_003612059.1| Soluble inorganic pyrophosphatase [Medicago truncatula] gi|355513394|gb|AES95017.1| Soluble inorganic pyrophosphatase [Medicago truncatula] Length = 154 Score = 60.1 bits (144), Expect = 2e-07 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +3 Query: 3 DPEFRHYTKIEELAPHRLAEIRRFFEDCI 89 DPEFRHYT I+EL PHRLAEIRRFFEDCI Sbjct: 78 DPEFRHYTDIKELPPHRLAEIRRFFEDCI 106 >ref|XP_003612057.1| Soluble inorganic pyrophosphatase [Medicago truncatula] gi|355513392|gb|AES95015.1| Soluble inorganic pyrophosphatase [Medicago truncatula] Length = 222 Score = 60.1 bits (144), Expect = 2e-07 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +3 Query: 3 DPEFRHYTKIEELAPHRLAEIRRFFEDCI 89 DPEFRHYT I+EL PHRLAEIRRFFEDCI Sbjct: 146 DPEFRHYTDIKELPPHRLAEIRRFFEDCI 174 >gb|AFW74916.1| hypothetical protein ZEAMMB73_605071 [Zea mays] Length = 206 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 4/41 (9%) Frame = +3 Query: 3 DPEFRHYTKIEELAPHRLAEIRRFFEDC----IHQYALQLS 113 DPE+RHY I+EL PHRLAEIRRFFEDC IHQY + L+ Sbjct: 147 DPEYRHYNDIKELPPHRLAEIRRFFEDCILFMIHQYFVLLT 187 >gb|AFW74913.1| hypothetical protein ZEAMMB73_875183 [Zea mays] Length = 97 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 4/41 (9%) Frame = +3 Query: 3 DPEFRHYTKIEELAPHRLAEIRRFFEDC----IHQYALQLS 113 DPE+RHY I+EL PHRLAEIRRFFEDC IHQY + L+ Sbjct: 38 DPEYRHYNDIKELPPHRLAEIRRFFEDCILFMIHQYFVLLT 78 >gb|ACF74329.1| putative inorganic pyrophosphatase [Arachis hypogaea] Length = 133 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = +3 Query: 3 DPEFRHYTKIEELAPHRLAEIRRFFEDCI 89 DPE+RHY I+EL PHRLAEIRRFFEDCI Sbjct: 94 DPEYRHYNDIKELPPHRLAEIRRFFEDCI 122