BLASTX nr result
ID: Lithospermum22_contig00021393
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00021393 (258 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002869184.1| hypothetical protein ARALYDRAFT_328350 [Arab... 59 3e-07 ref|NP_567943.1| RING/U-box domain-containing protein [Arabidops... 58 7e-07 dbj|BAC43725.1| unknown protein [Arabidopsis thaliana] 58 7e-07 emb|CAA19876.1| putative protein [Arabidopsis thaliana] gi|72703... 58 7e-07 gb|AAM62531.1| unknown [Arabidopsis thaliana] 58 7e-07 >ref|XP_002869184.1| hypothetical protein ARALYDRAFT_328350 [Arabidopsis lyrata subsp. lyrata] gi|297315020|gb|EFH45443.1| hypothetical protein ARALYDRAFT_328350 [Arabidopsis lyrata subsp. lyrata] Length = 683 Score = 59.3 bits (142), Expect = 3e-07 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = +2 Query: 170 ETPPTDDVCPICHDDFYVPCKTNCGHWFC 256 ETPP DDVCPIC F VPC+ NCGHW+C Sbjct: 66 ETPPEDDVCPICFGSFTVPCRGNCGHWYC 94 >ref|NP_567943.1| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|63003762|gb|AAY25410.1| At4g33940 [Arabidopsis thaliana] gi|87116618|gb|ABD19673.1| At4g33940 [Arabidopsis thaliana] gi|332660897|gb|AEE86297.1| RING/U-box domain-containing protein [Arabidopsis thaliana] Length = 262 Score = 58.2 bits (139), Expect = 7e-07 Identities = 22/37 (59%), Positives = 26/37 (70%) Frame = +2 Query: 146 RG*TRNIMETPPTDDVCPICHDDFYVPCKTNCGHWFC 256 RG + E+PP DDVCPIC F VPC+ NCGHW+C Sbjct: 58 RGERKIESESPPEDDVCPICFGSFTVPCRGNCGHWYC 94 >dbj|BAC43725.1| unknown protein [Arabidopsis thaliana] Length = 252 Score = 58.2 bits (139), Expect = 7e-07 Identities = 22/37 (59%), Positives = 26/37 (70%) Frame = +2 Query: 146 RG*TRNIMETPPTDDVCPICHDDFYVPCKTNCGHWFC 256 RG + E+PP DDVCPIC F VPC+ NCGHW+C Sbjct: 48 RGERKIESESPPEDDVCPICFGSFTVPCRGNCGHWYC 84 >emb|CAA19876.1| putative protein [Arabidopsis thaliana] gi|7270343|emb|CAB80111.1| putative protein [Arabidopsis thaliana] Length = 670 Score = 58.2 bits (139), Expect = 7e-07 Identities = 22/37 (59%), Positives = 26/37 (70%) Frame = +2 Query: 146 RG*TRNIMETPPTDDVCPICHDDFYVPCKTNCGHWFC 256 RG + E+PP DDVCPIC F VPC+ NCGHW+C Sbjct: 58 RGERKIESESPPEDDVCPICFGSFTVPCRGNCGHWYC 94 >gb|AAM62531.1| unknown [Arabidopsis thaliana] Length = 262 Score = 58.2 bits (139), Expect = 7e-07 Identities = 22/37 (59%), Positives = 26/37 (70%) Frame = +2 Query: 146 RG*TRNIMETPPTDDVCPICHDDFYVPCKTNCGHWFC 256 RG + E+PP DDVCPIC F VPC+ NCGHW+C Sbjct: 58 RGKRKIESESPPEDDVCPICFGSFTVPCRGNCGHWYC 94