BLASTX nr result
ID: Lithospermum22_contig00021389
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00021389 (688 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002300523.1| predicted protein [Populus trichocarpa] gi|2... 74 2e-11 ref|XP_002317041.1| predicted protein [Populus trichocarpa] gi|2... 71 2e-10 gb|AFW72819.1| hypothetical protein ZEAMMB73_541827, partial [Ze... 67 4e-09 gb|EEC77850.1| hypothetical protein OsI_17104 [Oryza sativa Indi... 66 6e-09 ref|XP_002454471.1| hypothetical protein SORBIDRAFT_04g031700 [S... 65 2e-08 >ref|XP_002300523.1| predicted protein [Populus trichocarpa] gi|222847781|gb|EEE85328.1| predicted protein [Populus trichocarpa] Length = 54 Score = 74.3 bits (181), Expect = 2e-11 Identities = 38/49 (77%), Positives = 43/49 (87%) Frame = +2 Query: 158 MILVAIVAEMLEGYTVMLTRVLQHMFHDAPLPFPRRVRFLILRNLPFAS 304 MILVAIVAE++E Y LTRVL+H+F+DA PFPRRVRFLILRNLPFAS Sbjct: 1 MILVAIVAELMEEYMAFLTRVLEHVFNDA--PFPRRVRFLILRNLPFAS 47 >ref|XP_002317041.1| predicted protein [Populus trichocarpa] gi|222860106|gb|EEE97653.1| predicted protein [Populus trichocarpa] Length = 58 Score = 70.9 bits (172), Expect = 2e-10 Identities = 35/49 (71%), Positives = 43/49 (87%) Frame = +2 Query: 158 MILVAIVAEMLEGYTVMLTRVLQHMFHDAPLPFPRRVRFLILRNLPFAS 304 MILVAI+AE++E YT +LT VL+H+F++A PFPRRVRFLIL NLPFAS Sbjct: 1 MILVAIMAELMEEYTALLTSVLEHLFNEA--PFPRRVRFLILHNLPFAS 47 >gb|AFW72819.1| hypothetical protein ZEAMMB73_541827, partial [Zea mays] Length = 126 Score = 66.6 bits (161), Expect = 4e-09 Identities = 33/52 (63%), Positives = 43/52 (82%) Frame = +2 Query: 149 ARKMILVAIVAEMLEGYTVMLTRVLQHMFHDAPLPFPRRVRFLILRNLPFAS 304 A +MILVAIVAE+LE YT ++ RVL+ + H A PFPRR+RFL+LR+LPFA+ Sbjct: 56 AHQMILVAIVAELLEEYTALVARVLEQLLHGA--PFPRRMRFLMLRSLPFAT 105 >gb|EEC77850.1| hypothetical protein OsI_17104 [Oryza sativa Indica Group] gi|222629424|gb|EEE61556.1| hypothetical protein OsJ_15902 [Oryza sativa Japonica Group] Length = 65 Score = 66.2 bits (160), Expect = 6e-09 Identities = 32/47 (68%), Positives = 42/47 (89%) Frame = +2 Query: 158 MILVAIVAEMLEGYTVMLTRVLQHMFHDAPLPFPRRVRFLILRNLPF 298 MILVA+VAE+LE YTV++ RVL+ +F+DA PFPRR+RFL+LR+LPF Sbjct: 1 MILVAVVAELLEEYTVLVARVLEQLFNDA--PFPRRMRFLMLRSLPF 45 >ref|XP_002454471.1| hypothetical protein SORBIDRAFT_04g031700 [Sorghum bicolor] gi|241934302|gb|EES07447.1| hypothetical protein SORBIDRAFT_04g031700 [Sorghum bicolor] Length = 62 Score = 64.7 bits (156), Expect = 2e-08 Identities = 32/49 (65%), Positives = 41/49 (83%) Frame = +2 Query: 158 MILVAIVAEMLEGYTVMLTRVLQHMFHDAPLPFPRRVRFLILRNLPFAS 304 MILVAIVAE+LE YT ++ RVL+ + H A PFPRR+RFL+LR+LPFA+ Sbjct: 1 MILVAIVAELLEEYTALVARVLEQLLHGA--PFPRRMRFLMLRSLPFAA 47