BLASTX nr result
ID: Lithospermum22_contig00021077
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00021077 (219 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530209.1| hypothetical protein RCOM_0346450 [Ricinus c... 70 2e-10 ref|XP_002320522.1| predicted protein [Populus trichocarpa] gi|2... 65 8e-09 ref|XP_003633332.1| PREDICTED: uncharacterized protein LOC100251... 57 2e-06 ref|XP_003618053.1| hypothetical protein MTR_5g098480 [Medicago ... 56 3e-06 >ref|XP_002530209.1| hypothetical protein RCOM_0346450 [Ricinus communis] gi|223530256|gb|EEF32156.1| hypothetical protein RCOM_0346450 [Ricinus communis] Length = 231 Score = 69.7 bits (169), Expect = 2e-10 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = +1 Query: 88 TMFKQQSILDLFREINEMSIEEENLIEIDIAMGSIKCPRFEIEA 219 + FKQ +++L E+N+M+IEEENLIEIDI+MGSIKCPRFEIEA Sbjct: 188 SFFKQHGLMELLAELNDMNIEEENLIEIDISMGSIKCPRFEIEA 231 >ref|XP_002320522.1| predicted protein [Populus trichocarpa] gi|222861295|gb|EEE98837.1| predicted protein [Populus trichocarpa] Length = 251 Score = 64.7 bits (156), Expect = 8e-09 Identities = 31/44 (70%), Positives = 38/44 (86%) Frame = +1 Query: 88 TMFKQQSILDLFREINEMSIEEENLIEIDIAMGSIKCPRFEIEA 219 + FKQ +++L E+NEM+ EEENLIEIDI+MGSIKCPRFEIEA Sbjct: 209 SFFKQHGLMELLAELNEMN-EEENLIEIDISMGSIKCPRFEIEA 251 >ref|XP_003633332.1| PREDICTED: uncharacterized protein LOC100251126 [Vitis vinifera] Length = 262 Score = 57.0 bits (136), Expect = 2e-06 Identities = 30/45 (66%), Positives = 39/45 (86%), Gaps = 1/45 (2%) Frame = +1 Query: 88 TMFKQQS-ILDLFREINEMSIEEENLIEIDIAMGSIKCPRFEIEA 219 ++F+Q S +++L E+NEM+ EEENLIEIDI+MGSIKC RFEIEA Sbjct: 219 SIFQQHSTLMELLAEMNEMN-EEENLIEIDISMGSIKCSRFEIEA 262 >ref|XP_003618053.1| hypothetical protein MTR_5g098480 [Medicago truncatula] gi|355519388|gb|AET01012.1| hypothetical protein MTR_5g098480 [Medicago truncatula] Length = 205 Score = 56.2 bits (134), Expect = 3e-06 Identities = 31/62 (50%), Positives = 42/62 (67%) Frame = +1 Query: 34 SFHQFNEPMFGFFGTETKTMFKQQSILDLFREINEMSIEEENLIEIDIAMGSIKCPRFEI 213 S Q + +FG +F QQS+++L E+NE++ EEEN IEID++MGSIK RFEI Sbjct: 151 SLQQKKKELFG------DALFSQQSLMELLSELNEVN-EEENFIEIDLSMGSIKYSRFEI 203 Query: 214 EA 219 EA Sbjct: 204 EA 205