BLASTX nr result
ID: Lithospermum22_contig00021073
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00021073 (322 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004167806.1| PREDICTED: survival of motor neuron-related-... 71 1e-10 ref|XP_004142808.1| PREDICTED: survival of motor neuron-related-... 71 1e-10 ref|XP_002328804.1| predicted protein [Populus trichocarpa] gi|1... 70 2e-10 ref|XP_002269518.2| PREDICTED: survival of motor neuron-related-... 69 3e-10 ref|XP_002527827.1| survival motor neuron protein, putative [Ric... 67 2e-09 >ref|XP_004167806.1| PREDICTED: survival of motor neuron-related-splicing factor 30-like, partial [Cucumis sativus] Length = 116 Score = 70.9 bits (172), Expect = 1e-10 Identities = 33/46 (71%), Positives = 41/46 (89%) Frame = -3 Query: 140 GGEEVSIEELASNLTTYKTQLNQVRTLLEGEPGNAELVDMEKELAE 3 GGE+VSIEELA+NL+TYK QL+QVR LL+ +PGN+E +DMEKEL E Sbjct: 3 GGEDVSIEELANNLSTYKDQLHQVRQLLDDDPGNSEYIDMEKELEE 48 >ref|XP_004142808.1| PREDICTED: survival of motor neuron-related-splicing factor 30-like isoform 1 [Cucumis sativus] Length = 299 Score = 70.9 bits (172), Expect = 1e-10 Identities = 33/46 (71%), Positives = 41/46 (89%) Frame = -3 Query: 140 GGEEVSIEELASNLTTYKTQLNQVRTLLEGEPGNAELVDMEKELAE 3 GGE+VSIEELA+NL+TYK QL+QVR LL+ +PGN+E +DMEKEL E Sbjct: 3 GGEDVSIEELANNLSTYKDQLHQVRQLLDDDPGNSEYIDMEKELEE 48 >ref|XP_002328804.1| predicted protein [Populus trichocarpa] gi|118483337|gb|ABK93570.1| unknown [Populus trichocarpa] gi|222839102|gb|EEE77453.1| predicted protein [Populus trichocarpa] Length = 287 Score = 69.7 bits (169), Expect = 2e-10 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = -3 Query: 137 GEEVSIEELASNLTTYKTQLNQVRTLLEGEPGNAELVDMEKELAE 3 GEEVSIEELASNL+TYK QL+QVR LL +PGN+E VDMEKEL E Sbjct: 3 GEEVSIEELASNLSTYKEQLHQVRQLLVDDPGNSEYVDMEKELIE 47 >ref|XP_002269518.2| PREDICTED: survival of motor neuron-related-splicing factor 30-like [Vitis vinifera] Length = 301 Score = 69.3 bits (168), Expect = 3e-10 Identities = 34/46 (73%), Positives = 39/46 (84%) Frame = -3 Query: 140 GGEEVSIEELASNLTTYKTQLNQVRTLLEGEPGNAELVDMEKELAE 3 GGEE+SI+ELASNL+TYK QL QVR LL +PGN+E VDMEKEL E Sbjct: 3 GGEELSIDELASNLSTYKDQLQQVRKLLVDDPGNSEYVDMEKELEE 48 >ref|XP_002527827.1| survival motor neuron protein, putative [Ricinus communis] gi|223532751|gb|EEF34530.1| survival motor neuron protein, putative [Ricinus communis] Length = 57 Score = 67.0 bits (162), Expect = 2e-09 Identities = 34/46 (73%), Positives = 38/46 (82%) Frame = -3 Query: 140 GGEEVSIEELASNLTTYKTQLNQVRTLLEGEPGNAELVDMEKELAE 3 GGEEVSIEELASNL+TYK QL+QVR LL +P N+E DMEKEL E Sbjct: 3 GGEEVSIEELASNLSTYKQQLHQVRELLVDDPYNSEYADMEKELKE 48