BLASTX nr result
ID: Lithospermum22_contig00021028
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00021028 (210 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004155826.1| PREDICTED: RNA polymerase I-specific transcr... 62 6e-08 ref|XP_004133864.1| PREDICTED: RNA polymerase I-specific transcr... 62 6e-08 ref|XP_002263973.2| PREDICTED: RNA polymerase I-specific transcr... 60 2e-07 emb|CBI37506.3| unnamed protein product [Vitis vinifera] 60 2e-07 emb|CAN73685.1| hypothetical protein VITISV_019843 [Vitis vinifera] 55 5e-06 >ref|XP_004155826.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3-like [Cucumis sativus] Length = 625 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/49 (57%), Positives = 36/49 (73%) Frame = +2 Query: 62 DMCLSMLVDNFVPPDDPVRILNEPRPRTRKSRVLERVHSTLKDIADLVP 208 D CL MLV+NF+PP+ + +L +P TRK VL RVH+ LKDI+DLVP Sbjct: 123 DSCLDMLVNNFMPPNSYMDLLKKPHGLTRKEEVLSRVHTALKDISDLVP 171 >ref|XP_004133864.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3-like [Cucumis sativus] Length = 626 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/49 (57%), Positives = 36/49 (73%) Frame = +2 Query: 62 DMCLSMLVDNFVPPDDPVRILNEPRPRTRKSRVLERVHSTLKDIADLVP 208 D CL MLV+NF+PP+ + +L +P TRK VL RVH+ LKDI+DLVP Sbjct: 123 DSCLDMLVNNFMPPNSYMDLLKKPHGLTRKEEVLSRVHTALKDISDLVP 171 >ref|XP_002263973.2| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3-like [Vitis vinifera] Length = 636 Score = 60.1 bits (144), Expect = 2e-07 Identities = 30/49 (61%), Positives = 34/49 (69%) Frame = +2 Query: 62 DMCLSMLVDNFVPPDDPVRILNEPRPRTRKSRVLERVHSTLKDIADLVP 208 D L MLV NF+PP + L +PR RK +VL RVHSTLKDIADLVP Sbjct: 123 DCSLDMLVSNFMPPYSLLDFLKQPRGLARKDQVLSRVHSTLKDIADLVP 171 >emb|CBI37506.3| unnamed protein product [Vitis vinifera] Length = 607 Score = 60.1 bits (144), Expect = 2e-07 Identities = 30/49 (61%), Positives = 34/49 (69%) Frame = +2 Query: 62 DMCLSMLVDNFVPPDDPVRILNEPRPRTRKSRVLERVHSTLKDIADLVP 208 D L MLV NF+PP + L +PR RK +VL RVHSTLKDIADLVP Sbjct: 123 DCSLDMLVSNFMPPYSLLDFLKQPRGLARKDQVLSRVHSTLKDIADLVP 171 >emb|CAN73685.1| hypothetical protein VITISV_019843 [Vitis vinifera] Length = 1337 Score = 55.5 bits (132), Expect = 5e-06 Identities = 27/49 (55%), Positives = 34/49 (69%) Frame = +2 Query: 62 DMCLSMLVDNFVPPDDPVRILNEPRPRTRKSRVLERVHSTLKDIADLVP 208 D CL MLV NF+PP + +L + R RK +VL RVHST +DI+DLVP Sbjct: 1113 DGCLDMLVSNFMPPYSFLDLLKQSRGLARKDQVLSRVHSTSEDISDLVP 1161