BLASTX nr result
ID: Lithospermum22_contig00020989
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00020989 (417 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532924.1| transferase, transferring glycosyl groups, p... 70 2e-10 ref|XP_002315348.1| predicted protein [Populus trichocarpa] gi|2... 66 3e-09 ref|XP_003536299.1| PREDICTED: uncharacterized protein LOC100789... 62 5e-08 ref|NP_196070.2| glycosyltransferase family protein 47 [Arabidop... 62 6e-08 emb|CAB85556.1| putative protein [Arabidopsis thaliana] 62 6e-08 >ref|XP_002532924.1| transferase, transferring glycosyl groups, putative [Ricinus communis] gi|223527317|gb|EEF29466.1| transferase, transferring glycosyl groups, putative [Ricinus communis] Length = 704 Score = 69.7 bits (169), Expect = 2e-10 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = -3 Query: 415 AISGNTQVHYNIRSNCLQKFAELYGSIADRKSEFSWRTDGWD 290 AIS NTQ HY IRS+CLQKF+E+YGS+A RKSEF R DGWD Sbjct: 662 AISRNTQAHYKIRSSCLQKFSEMYGSLAGRKSEFDRRKDGWD 703 >ref|XP_002315348.1| predicted protein [Populus trichocarpa] gi|222864388|gb|EEF01519.1| predicted protein [Populus trichocarpa] Length = 847 Score = 66.2 bits (160), Expect = 3e-09 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = -3 Query: 415 AISGNTQVHYNIRSNCLQKFAELYGSIADRKSEFSWRTDGWD 290 AIS NT VHY IRSNCL KF+++YGSIA RK EF+ R DGWD Sbjct: 805 AISKNTNVHYEIRSNCLLKFSDIYGSIAGRKWEFNGRKDGWD 846 >ref|XP_003536299.1| PREDICTED: uncharacterized protein LOC100789310 [Glycine max] Length = 768 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = -3 Query: 415 AISGNTQVHYNIRSNCLQKFAELYGSIADRKSEFSWRTDGWD 290 AIS NT+VHY +RS+CL KF+E+YGS+A RK F R DGWD Sbjct: 726 AISRNTKVHYQLRSHCLMKFSEMYGSLAGRKWGFDSRNDGWD 767 >ref|NP_196070.2| glycosyltransferase family protein 47 [Arabidopsis thaliana] gi|28393253|gb|AAO42055.1| unknown protein [Arabidopsis thaliana] gi|332003370|gb|AED90753.1| glycosyltransferase family protein 47 [Arabidopsis thaliana] Length = 765 Score = 61.6 bits (148), Expect = 6e-08 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = -3 Query: 415 AISGNTQVHYNIRSNCLQKFAELYGSIADRKSEFSWRTDGWD 290 AISGNT HY RS CL++F++LYGS+ DR+ EF R DGWD Sbjct: 723 AISGNTNQHYRKRSKCLRRFSDLYGSLVDRRWEFGGRKDGWD 764 >emb|CAB85556.1| putative protein [Arabidopsis thaliana] Length = 764 Score = 61.6 bits (148), Expect = 6e-08 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = -3 Query: 415 AISGNTQVHYNIRSNCLQKFAELYGSIADRKSEFSWRTDGWD 290 AISGNT HY RS CL++F++LYGS+ DR+ EF R DGWD Sbjct: 722 AISGNTNQHYRKRSKCLRRFSDLYGSLVDRRWEFGGRKDGWD 763