BLASTX nr result
ID: Lithospermum22_contig00020962
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00020962 (257 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003606712.1| Pumilio-like protein [Medicago truncatula] g... 55 6e-06 ref|XP_002524201.1| pumilio, putative [Ricinus communis] gi|2235... 55 8e-06 >ref|XP_003606712.1| Pumilio-like protein [Medicago truncatula] gi|355507767|gb|AES88909.1| Pumilio-like protein [Medicago truncatula] Length = 1025 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = +1 Query: 40 ISEEEIRSDPAXXXXXXXXXXMNPRLPPPLLSKEDWRRQ 156 +SEEE+RSDPA +NPRLPPPLLSKEDWR Q Sbjct: 90 VSEEELRSDPAYLQYYYSNVNLNPRLPPPLLSKEDWRFQ 128 >ref|XP_002524201.1| pumilio, putative [Ricinus communis] gi|223536478|gb|EEF38125.1| pumilio, putative [Ricinus communis] Length = 999 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = +1 Query: 40 ISEEEIRSDPAXXXXXXXXXXMNPRLPPPLLSKEDWR 150 +SEEEIRSDPA +NPRLPPPLLSKEDWR Sbjct: 86 LSEEEIRSDPAYVNYYYSNVNLNPRLPPPLLSKEDWR 122