BLASTX nr result
ID: Lithospermum22_contig00020863
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00020863 (283 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001150187.1| PP2Ac-2 - Phosphatase 2A isoform 2 belonging... 57 1e-06 >ref|NP_001150187.1| PP2Ac-2 - Phosphatase 2A isoform 2 belonging to family 2 [Zea mays] gi|195637408|gb|ACG38172.1| PP2Ac-2 - Phosphatase 2A isoform 2 belonging to family 2 [Zea mays] Length = 232 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/40 (65%), Positives = 30/40 (75%) Frame = +2 Query: 2 YGNASVWKTFTDLFDYFPLTALVSRSVIFHKSFFLFYHHP 121 YGNA+VWKTFTDLFDYFPLTALV + F + + Y HP Sbjct: 135 YGNANVWKTFTDLFDYFPLTALVESEIFF--ACMVDYRHP 172